Detailed information of TA system TA278726

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 97165..97591
• Replicon: plasmid pMB7355_1
• Accession: NZ_CP123238
• Organism: Escherichia coli strain 4588

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QET42_RS23900
• Protein ID: WP_001372321.1
• Coordinates: 97165..97290 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	97367..97591 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QET42_RS23860 (92537)	92537..93226	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
QET42_RS23865 (93413)	93413..93796	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QET42_RS23870 (94129)	94129..94719	+	591	WP_186235717.1	transglycosylase SLT domain-containing protein	-
QET42_RS23875 (95016)	95016..95837	-	822	WP_001234469.1	DUF932 domain-containing protein	-
QET42_RS23880 (95956)	95956..96243	-	288	WP_000107535.1	hypothetical protein	-
QET42_RS23885 (96268)	96268..96474	-	207	WP_000547971.1	hypothetical protein	-
QET42_RS23890 (96544)	96544..96717	+	174	Protein_119	hypothetical protein	-
QET42_RS23895 (96715)	96715..96945	-	231	WP_001426396.1	hypothetical protein	-
QET42_RS23900 (97165)	97165..97290	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QET42_RS23905 (97232)	97232..97381	-	150	Protein_122	plasmid maintenance protein Mok	-
- (97367)	97367..97591	-	225	NuclAT_0	-	Antitoxin
- (97367)	97367..97591	-	225	NuclAT_0	-	Antitoxin
- (97367)	97367..97591	-	225	NuclAT_0	-	Antitoxin
- (97367)	97367..97591	-	225	NuclAT_0	-	Antitoxin
QET42_RS23910 (97403)	97403..97591	+	189	WP_001299721.1	hypothetical protein	-
QET42_RS23915 (97560)	97560..98322	-	763	Protein_124	plasmid SOS inhibition protein A	-
QET42_RS23920 (98319)	98319..98753	-	435	WP_064770609.1	conjugation system SOS inhibitor PsiB	-
QET42_RS23925 (98808)	98808..99005	-	198	Protein_126	hypothetical protein	-
QET42_RS23930 (99033)	99033..99266	-	234	WP_000005987.1	DUF905 family protein	-
QET42_RS23935 (99334)	99334..99873	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
QET42_RS23940 (99899)	99899..100105	-	207	WP_000275856.1	hypothetical protein	-
QET42_RS23945 (100175)	100175..100255	+	81	Protein_130	hypothetical protein	-
QET42_RS23950 (100438)	100438..100607	-	170	Protein_131	hypothetical protein	-
QET42_RS23955 (101244)	101244..102215	-	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaCTX-M-55 / ant(3'')-Ia / sul3 / lnu(F) / sitABCD	iutA / iucD / iucC / iucB / iucA	1..122596	122596

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T278726 WP_001372321.1 NZ_CP123238:c97290-97165 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT278726 NZ_CP123238:c97591-97367 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin