Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 56371..56625 | Replicon | plasmid pMB7355_1 |
| Accession | NZ_CP123238 | ||
| Organism | Escherichia coli strain 4588 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | QET42_RS23645 | Protein ID | WP_001312851.1 |
| Coordinates | 56371..56520 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 56564..56625 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QET42_RS23605 (51923) | 51923..52324 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| QET42_RS23610 (52257) | 52257..52514 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| QET42_RS23615 (52607) | 52607..53260 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| QET42_RS23620 (54199) | 54199..55056 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| QET42_RS23625 (55049) | 55049..55531 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| QET42_RS23630 (55524) | 55524..55571 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| QET42_RS23635 (55562) | 55562..55813 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| QET42_RS23640 (55830) | 55830..56087 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| QET42_RS23645 (56371) | 56371..56520 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (56564) | 56564..56625 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (56564) | 56564..56625 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (56564) | 56564..56625 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (56564) | 56564..56625 | + | 62 | NuclAT_1 | - | Antitoxin |
| QET42_RS23650 (56881) | 56881..56955 | - | 75 | Protein_71 | endonuclease | - |
| QET42_RS23655 (57201) | 57201..57413 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| QET42_RS23660 (57549) | 57549..58109 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| QET42_RS23665 (58212) | 58212..59072 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| QET42_RS23670 (59131) | 59131..59877 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-55 / ant(3'')-Ia / sul3 / lnu(F) / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..122596 | 122596 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T278721 WP_001312851.1 NZ_CP123238:c56520-56371 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT278721 NZ_CP123238:56564-56625 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
