Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3703816..3704510 | Replicon | chromosome |
| Accession | NZ_CP123237 | ||
| Organism | Escherichia coli strain 4588 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q47157 |
| Locus tag | QET42_RS18300 | Protein ID | WP_001263489.1 |
| Coordinates | 3703816..3704214 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | QET42_RS18305 | Protein ID | WP_000554758.1 |
| Coordinates | 3704217..3704510 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3699404) | 3699404..3699484 | - | 81 | NuclAT_10 | - | - |
| - (3699404) | 3699404..3699484 | - | 81 | NuclAT_10 | - | - |
| - (3699404) | 3699404..3699484 | - | 81 | NuclAT_10 | - | - |
| - (3699404) | 3699404..3699484 | - | 81 | NuclAT_10 | - | - |
| QET42_RS18275 (3700080) | 3700080..3700538 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| QET42_RS18280 (3700799) | 3700799..3702256 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
| QET42_RS18285 (3702313) | 3702313..3702834 | - | 522 | Protein_3578 | peptide chain release factor H | - |
| QET42_RS18290 (3702830) | 3702830..3703036 | - | 207 | Protein_3579 | RtcB family protein | - |
| QET42_RS18295 (3703354) | 3703354..3703806 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
| QET42_RS18300 (3703816) | 3703816..3704214 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| QET42_RS18305 (3704217) | 3704217..3704510 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| QET42_RS18310 (3704562) | 3704562..3705617 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| QET42_RS18315 (3705688) | 3705688..3706473 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
| QET42_RS18320 (3706445) | 3706445..3708157 | + | 1713 | Protein_3585 | flagellar biosynthesis protein FlhA | - |
| QET42_RS18325 (3708381) | 3708381..3708878 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T278716 WP_001263489.1 NZ_CP123237:c3704214-3703816 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A090J8B1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1QAE3 |