Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 45132..45396 Replicon plasmid pMB11100_1
Accession NZ_CP123232
Organism Escherichia coli strain 5132

Toxin (Protein)


Gene name pndA Uniprot ID E6BRV3
Locus tag QET41_RS24560 Protein ID WP_001303307.1
Coordinates 45244..45396 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 45132..45189 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QET41_RS24545 (40371) 40371..42662 - 2292 WP_001289282.1 F-type conjugative transfer protein TrbC -
QET41_RS24550 (42655) 42655..43725 - 1071 WP_000151582.1 IncI1-type conjugal transfer protein TrbB -
QET41_RS24555 (43744) 43744..44952 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- (45132) 45132..45189 - 58 NuclAT_0 - Antitoxin
- (45132) 45132..45189 - 58 NuclAT_0 - Antitoxin
- (45132) 45132..45189 - 58 NuclAT_0 - Antitoxin
- (45132) 45132..45189 - 58 NuclAT_0 - Antitoxin
QET41_RS24560 (45244) 45244..45396 + 153 WP_001303307.1 Hok/Gef family protein Toxin
QET41_RS24565 (45468) 45468..45719 - 252 WP_001291965.1 hypothetical protein -
QET41_RS24570 (46218) 46218..46313 + 96 WP_001303310.1 DinQ-like type I toxin DqlB -
QET41_RS24575 (46378) 46378..46554 - 177 WP_001054897.1 hypothetical protein -
QET41_RS24580 (46946) 46946..47155 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
QET41_RS24585 (47227) 47227..47877 - 651 WP_001178506.1 plasmid IncI1-type surface exclusion protein ExcA -
QET41_RS24590 (47951) 47951..50119 - 2169 WP_000698357.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(B) - 1..91437 91437


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5817.21 Da        Isoelectric Point: 8.7948

>T278694 WP_001303307.1 NZ_CP123232:45244-45396 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT278694 NZ_CP123232:c45189-45132 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A634Q5L1

Antitoxin

Download structure file

References