Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4765981..4766583 | Replicon | chromosome |
Accession | NZ_CP123231 | ||
Organism | Escherichia coli strain 5132 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1P416 |
Locus tag | QET41_RS23225 | Protein ID | WP_000897302.1 |
Coordinates | 4766272..4766583 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QET41_RS23220 | Protein ID | WP_000356397.1 |
Coordinates | 4765981..4766271 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QET41_RS23195 (4762054) | 4762054..4762956 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
QET41_RS23200 (4762953) | 4762953..4763588 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
QET41_RS23205 (4763585) | 4763585..4764514 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
QET41_RS23210 (4764730) | 4764730..4764948 | - | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
QET41_RS23215 (4765344) | 4765344..4765622 | - | 279 | WP_001296612.1 | hypothetical protein | - |
QET41_RS23220 (4765981) | 4765981..4766271 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
QET41_RS23225 (4766272) | 4766272..4766583 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
QET41_RS23230 (4766812) | 4766812..4767720 | + | 909 | WP_001774092.1 | alpha/beta hydrolase | - |
QET41_RS23235 (4767784) | 4767784..4768725 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
QET41_RS23240 (4768770) | 4768770..4769207 | - | 438 | WP_000560978.1 | D-aminoacyl-tRNA deacylase | - |
QET41_RS23245 (4769204) | 4769204..4770076 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
QET41_RS23250 (4770070) | 4770070..4770669 | - | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
QET41_RS23255 (4770768) | 4770768..4771553 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T278693 WP_000897302.1 NZ_CP123231:c4766583-4766272 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|