Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4046732..4046990 | Replicon | chromosome |
| Accession | NZ_CP123231 | ||
| Organism | Escherichia coli strain 5132 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | QET41_RS19715 | Protein ID | WP_000809168.1 |
| Coordinates | 4046838..4046990 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 4046732..4046789 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QET41_RS19700 | 4042561..4043820 | - | 1260 | WP_000494929.1 | hypothetical protein | - |
| QET41_RS19705 | 4043949..4045442 | - | 1494 | WP_001774152.1 | sulfatase-like hydrolase/transferase | - |
| QET41_RS19710 | 4045462..4046223 | - | 762 | WP_001274832.1 | outer membrane protein OmpK | - |
| - | 4046732..4046789 | - | 58 | - | - | Antitoxin |
| QET41_RS19715 | 4046838..4046990 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| QET41_RS19720 | 4047095..4048225 | - | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
| QET41_RS19725 | 4048314..4050230 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
| QET41_RS19730 | 4050602..4051006 | + | 405 | WP_000843687.1 | DUF2541 family protein | - |
| QET41_RS19735 | 4051032..4051745 | + | 714 | WP_001102391.1 | acidic protein MsyB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T278685 WP_000809168.1 NZ_CP123231:4046838-4046990 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT278685 NZ_CP123231:c4046789-4046732 [Escherichia coli]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|