Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3734941..3735635 | Replicon | chromosome |
Accession | NZ_CP123231 | ||
Organism | Escherichia coli strain 5132 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1PJQ2 |
Locus tag | QET41_RS18235 | Protein ID | WP_001263500.1 |
Coordinates | 3734941..3735339 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | QET41_RS18240 | Protein ID | WP_000554758.1 |
Coordinates | 3735342..3735635 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QET41_RS18210 (3730306) | 3730306..3730764 | - | 459 | WP_001291991.1 | xanthine phosphoribosyltransferase | - |
QET41_RS18215 (3731025) | 3731025..3732482 | + | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
QET41_RS18220 (3732539) | 3732539..3733153 | - | 615 | WP_000602124.1 | peptide chain release factor H | - |
QET41_RS18225 (3733150) | 3733150..3734289 | - | 1140 | WP_000521561.1 | RNA ligase RtcB family protein | - |
QET41_RS18230 (3734479) | 3734479..3734931 | - | 453 | WP_001059895.1 | GNAT family N-acetyltransferase | - |
QET41_RS18235 (3734941) | 3734941..3735339 | - | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
QET41_RS18240 (3735342) | 3735342..3735635 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
QET41_RS18245 (3735687) | 3735687..3736742 | - | 1056 | WP_001226168.1 | DNA polymerase IV | - |
QET41_RS18250 (3736813) | 3736813..3737736 | - | 924 | WP_001532973.1 | putative lateral flagellar export/assembly protein LafU | - |
QET41_RS18255 (3737739) | 3737739..3738602 | - | 864 | WP_001169518.1 | flagellar motor stator protein MotA | - |
QET41_RS18260 (3738615) | 3738615..3739331 | - | 717 | WP_000938731.1 | FliA/WhiG family RNA polymerase sigma factor | - |
QET41_RS18265 (3739351) | 3739351..3739818 | - | 468 | WP_000725261.1 | flagellar basal body-associated FliL family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T278683 WP_001263500.1 NZ_CP123231:c3735339-3734941 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|