Detailed information of TA system TA278605

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 60982..61408
• Replicon: plasmid unnamed1
• Accession: NZ_CP123195
• Organism: Escherichia coli strain C-SRM-3

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PAE60_RS00375
• Protein ID: WP_001372321.1
• Coordinates: 61283..61408 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	60982..61206 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PAE60_RS00320 (56358)	56358..57329	+	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-
PAE60_RS00325 (57966)	57966..58135	+	170	Protein_64	hypothetical protein	-
PAE60_RS00330 (58318)	58318..58398	-	81	Protein_65	hypothetical protein	-
PAE60_RS00335 (58468)	58468..58674	+	207	WP_000275856.1	hypothetical protein	-
PAE60_RS00340 (58700)	58700..59239	+	540	WP_000290840.1	single-stranded DNA-binding protein	-
PAE60_RS00345 (59307)	59307..59540	+	234	WP_000005987.1	DUF905 family protein	-
PAE60_RS00350 (59568)	59568..59765	+	198	Protein_69	hypothetical protein	-
PAE60_RS00355 (59820)	59820..60254	+	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
PAE60_RS00360 (60251)	60251..61013	+	763	Protein_71	plasmid SOS inhibition protein A	-
PAE60_RS00365 (60982)	60982..61170	-	189	WP_001299721.1	hypothetical protein	-
- (60982)	60982..61206	+	225	NuclAT_0	-	Antitoxin
- (60982)	60982..61206	+	225	NuclAT_0	-	Antitoxin
- (60982)	60982..61206	+	225	NuclAT_0	-	Antitoxin
- (60982)	60982..61206	+	225	NuclAT_0	-	Antitoxin
PAE60_RS00370 (61192)	61192..61341	+	150	Protein_73	plasmid maintenance protein Mok	-
PAE60_RS00375 (61283)	61283..61408	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
PAE60_RS00380 (61628)	61628..61858	+	231	WP_071586998.1	hypothetical protein	-
PAE60_RS00385 (61856)	61856..62028	-	173	Protein_76	hypothetical protein	-
PAE60_RS00390 (62098)	62098..62304	+	207	WP_000547968.1	hypothetical protein	-
PAE60_RS00395 (62329)	62329..62616	+	288	WP_063121090.1	hypothetical protein	-
PAE60_RS00400 (62734)	62734..63555	+	822	WP_001234426.1	DUF932 domain-containing protein	-
PAE60_RS00405 (63852)	63852..64442	-	591	WP_001376243.1	transglycosylase SLT domain-containing protein	-
PAE60_RS00410 (64774)	64774..65157	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
PAE60_RS00415 (65344)	65344..66033	+	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaTEM-1B / sitABCD	iucA / iucB / iucC / iucD / iutA	1..68057	68057

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T278605 WP_001372321.1 NZ_CP123195:61283-61408 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT278605 NZ_CP123195:60982-61206 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin