Detailed information of TA system TA278596

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 112630..112899
• Replicon: plasmid pEC0430-2
• Accession: NZ_CP123048
• Organism: Escherichia coli strain EC0430

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QDU34_RS24945
• Protein ID: WP_001372321.1
• Coordinates: 112774..112899 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	112630..112695 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QDU34_RS24910	108188..108373	-	186	WP_280102462.1	abortive infection system antitoxin AbiGi family protein	-
QDU34_RS24915	108925..109158	+	234	WP_000006003.1	DUF905 family protein	-
QDU34_RS24920	109219..111242	+	2024	Protein_135	ParB/RepB/Spo0J family partition protein	-
QDU34_RS24925	111311..111745	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
QDU34_RS24930	111742..112504	+	763	Protein_137	plasmid SOS inhibition protein A	-
-	112473..112697	+	225	NuclAT_0	-	-
-	112473..112697	+	225	NuclAT_0	-	-
-	112473..112697	+	225	NuclAT_0	-	-
-	112473..112697	+	225	NuclAT_0	-	-
QDU34_RS24935	112482..112661	-	180	WP_001309233.1	hypothetical protein	-
-	112630..112695	-	66	-	-	Antitoxin
QDU34_RS24940	112683..112832	+	150	Protein_139	plasmid maintenance protein Mok	-
QDU34_RS24945	112774..112899	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QDU34_RS24950	113218..113514	-	297	Protein_141	hypothetical protein	-
QDU34_RS24955	113814..114110	+	297	WP_001272251.1	hypothetical protein	-
QDU34_RS24960	114294..114617	+	324	WP_280102463.1	DUF932 domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / aadA5 / qacE / sul1	-	1..114815	114815

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T278596 WP_001372321.1 NZ_CP123048:112774-112899 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT278596 NZ_CP123048:c112695-112630 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin