Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 112630..112899 | Replicon | plasmid pEC0430-2 |
| Accession | NZ_CP123048 | ||
| Organism | Escherichia coli strain EC0430 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QDU34_RS24945 | Protein ID | WP_001372321.1 |
| Coordinates | 112774..112899 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 112630..112695 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDU34_RS24910 | 108188..108373 | - | 186 | WP_280102462.1 | abortive infection system antitoxin AbiGi family protein | - |
| QDU34_RS24915 | 108925..109158 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| QDU34_RS24920 | 109219..111242 | + | 2024 | Protein_135 | ParB/RepB/Spo0J family partition protein | - |
| QDU34_RS24925 | 111311..111745 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| QDU34_RS24930 | 111742..112504 | + | 763 | Protein_137 | plasmid SOS inhibition protein A | - |
| - | 112473..112697 | + | 225 | NuclAT_0 | - | - |
| - | 112473..112697 | + | 225 | NuclAT_0 | - | - |
| - | 112473..112697 | + | 225 | NuclAT_0 | - | - |
| - | 112473..112697 | + | 225 | NuclAT_0 | - | - |
| QDU34_RS24935 | 112482..112661 | - | 180 | WP_001309233.1 | hypothetical protein | - |
| - | 112630..112695 | - | 66 | - | - | Antitoxin |
| QDU34_RS24940 | 112683..112832 | + | 150 | Protein_139 | plasmid maintenance protein Mok | - |
| QDU34_RS24945 | 112774..112899 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QDU34_RS24950 | 113218..113514 | - | 297 | Protein_141 | hypothetical protein | - |
| QDU34_RS24955 | 113814..114110 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| QDU34_RS24960 | 114294..114617 | + | 324 | WP_280102463.1 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / aadA5 / qacE / sul1 | - | 1..114815 | 114815 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T278596 WP_001372321.1 NZ_CP123048:112774-112899 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT278596 NZ_CP123048:c112695-112630 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|