Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 37303..37556 Replicon plasmid pEC0430-2
Accession NZ_CP123048
Organism Escherichia coli strain EC0430

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag QDU34_RS24455 Protein ID WP_001312851.1
Coordinates 37407..37556 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 37303..37362 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDU34_RS24430 (34030) 34030..34776 + 747 WP_000205770.1 conjugal transfer pilus acetylase TraX -
QDU34_RS24435 (34831) 34831..35391 + 561 WP_000139328.1 fertility inhibition protein FinO -
QDU34_RS24440 (35523) 35523..35723 + 201 WP_015059022.1 hypothetical protein -
QDU34_RS24445 (36109) 36109..36708 + 600 WP_032083981.1 PIN domain-containing protein -
QDU34_RS24450 (36770) 36770..37102 + 333 WP_152916585.1 hypothetical protein -
- (37303) 37303..37362 - 60 NuclAT_1 - Antitoxin
- (37303) 37303..37362 - 60 NuclAT_1 - Antitoxin
- (37303) 37303..37362 - 60 NuclAT_1 - Antitoxin
- (37303) 37303..37362 - 60 NuclAT_1 - Antitoxin
QDU34_RS24455 (37407) 37407..37556 + 150 WP_001312851.1 Hok/Gef family protein Toxin
QDU34_RS24460 (37840) 37840..38088 + 249 WP_000083837.1 replication regulatory protein RepA -
QDU34_RS24465 (38333) 38333..38407 + 75 WP_001375168.1 RepA leader peptide Tap -
QDU34_RS24470 (38400) 38400..39257 + 858 WP_032495102.1 incFII family plasmid replication initiator RepA -
QDU34_RS24475 (40196) 40196..40849 + 654 WP_000616807.1 CPBP family intramembrane metalloprotease -
QDU34_RS24480 (40942) 40942..41199 + 258 WP_000557619.1 type II toxin-antitoxin system antitoxin PemI -
QDU34_RS24485 (41132) 41132..41533 + 402 WP_001398199.1 type II toxin-antitoxin system toxin endoribonuclease PemK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / aadA5 / qacE / sul1 - 1..114815 114815


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T278592 WP_001312851.1 NZ_CP123048:37407-37556 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 60 bp

>AT278592 NZ_CP123048:c37362-37303 [Escherichia coli]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References