Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 37303..37556 | Replicon | plasmid pEC0430-2 |
| Accession | NZ_CP123048 | ||
| Organism | Escherichia coli strain EC0430 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | QDU34_RS24455 | Protein ID | WP_001312851.1 |
| Coordinates | 37407..37556 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 37303..37362 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDU34_RS24430 (34030) | 34030..34776 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| QDU34_RS24435 (34831) | 34831..35391 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| QDU34_RS24440 (35523) | 35523..35723 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| QDU34_RS24445 (36109) | 36109..36708 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| QDU34_RS24450 (36770) | 36770..37102 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (37303) | 37303..37362 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (37303) | 37303..37362 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (37303) | 37303..37362 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (37303) | 37303..37362 | - | 60 | NuclAT_1 | - | Antitoxin |
| QDU34_RS24455 (37407) | 37407..37556 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| QDU34_RS24460 (37840) | 37840..38088 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| QDU34_RS24465 (38333) | 38333..38407 | + | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| QDU34_RS24470 (38400) | 38400..39257 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| QDU34_RS24475 (40196) | 40196..40849 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| QDU34_RS24480 (40942) | 40942..41199 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| QDU34_RS24485 (41132) | 41132..41533 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / aadA5 / qacE / sul1 | - | 1..114815 | 114815 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T278592 WP_001312851.1 NZ_CP123048:37407-37556 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT278592 NZ_CP123048:c37362-37303 [Escherichia coli]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|