Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4634495..4635097 | Replicon | chromosome |
Accession | NZ_CP123046 | ||
Organism | Escherichia coli strain EC0430 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | QDU34_RS22230 | Protein ID | WP_000897305.1 |
Coordinates | 4634786..4635097 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QDU34_RS22225 | Protein ID | WP_000356397.1 |
Coordinates | 4634495..4634785 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDU34_RS22200 (4630420) | 4630420..4631322 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
QDU34_RS22205 (4631319) | 4631319..4631954 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
QDU34_RS22210 (4631951) | 4631951..4632880 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
QDU34_RS22215 (4633210) | 4633210..4633452 | - | 243 | WP_001087409.1 | protein YiiF | - |
QDU34_RS22220 (4633672) | 4633672..4633890 | - | 219 | WP_001315930.1 | CopG family transcriptional regulator | - |
QDU34_RS22225 (4634495) | 4634495..4634785 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
QDU34_RS22230 (4634786) | 4634786..4635097 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
QDU34_RS22235 (4635326) | 4635326..4636234 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
QDU34_RS22240 (4636298) | 4636298..4637239 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
QDU34_RS22245 (4637284) | 4637284..4637721 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
QDU34_RS22250 (4637718) | 4637718..4638590 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
QDU34_RS22255 (4638584) | 4638584..4639183 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
QDU34_RS22260 (4639282) | 4639282..4640067 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T278583 WP_000897305.1 NZ_CP123046:c4635097-4634786 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|