Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 599169..599968 | Replicon | chromosome |
Accession | NZ_CP123046 | ||
Organism | Escherichia coli strain EC0430 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | A0A6H2GMC5 |
Locus tag | QDU34_RS02935 | Protein ID | WP_000347279.1 |
Coordinates | 599169..599633 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | QDU34_RS02940 | Protein ID | WP_001307405.1 |
Coordinates | 599633..599968 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDU34_RS02905 (594170) | 594170..594604 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
QDU34_RS02910 (594622) | 594622..595500 | - | 879 | WP_001298758.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
QDU34_RS02915 (595490) | 595490..596269 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
QDU34_RS02920 (596280) | 596280..596753 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
QDU34_RS02925 (596776) | 596776..598056 | - | 1281 | WP_000681921.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
QDU34_RS02930 (598305) | 598305..599114 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
QDU34_RS02935 (599169) | 599169..599633 | - | 465 | WP_000347279.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
QDU34_RS02940 (599633) | 599633..599968 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
QDU34_RS02945 (600117) | 600117..601688 | - | 1572 | WP_001273741.1 | galactarate dehydratase | - |
QDU34_RS02950 (602063) | 602063..603397 | + | 1335 | WP_128995326.1 | galactarate/glucarate/glycerate transporter GarP | - |
QDU34_RS02955 (603413) | 603413..604183 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17869.24 Da Isoelectric Point: 9.4947
>T278567 WP_000347279.1 NZ_CP123046:c599633-599169 [Escherichia coli]
MDFPQRVNGWVLYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESFTQETEENH
MDFPQRVNGWVLYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESFTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6H2GMC5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |