Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 363764..364410 | Replicon | chromosome |
Accession | NZ_CP123043 | ||
Organism | Klebsiella pneumoniae strain KP161637 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A486RBU5 |
Locus tag | QDF61_RS01690 | Protein ID | WP_032410616.1 |
Coordinates | 363764..364111 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | W8UB68 |
Locus tag | QDF61_RS01695 | Protein ID | WP_002920557.1 |
Coordinates | 364111..364410 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDF61_RS01680 (359690) | 359690..361123 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
QDF61_RS01685 (361141) | 361141..363588 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
QDF61_RS01690 (363764) | 363764..364111 | + | 348 | WP_032410616.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QDF61_RS01695 (364111) | 364111..364410 | + | 300 | WP_002920557.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QDF61_RS01700 (364473) | 364473..365981 | - | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
QDF61_RS01705 (366186) | 366186..366515 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
QDF61_RS01710 (366566) | 366566..367396 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
QDF61_RS01715 (367446) | 367446..368204 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13545.55 Da Isoelectric Point: 5.6802
>T278552 WP_032410616.1 NZ_CP123043:363764-364111 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATILILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFEPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATILILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFEPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A486RBU5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E1CBF8 |