Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 337575..338161 Replicon chromosome
Accession NZ_CP123043
Organism Klebsiella pneumoniae strain KP161637

Toxin (Protein)


Gene name doc Uniprot ID A0A486RB10
Locus tag QDF61_RS01580 Protein ID WP_004174007.1
Coordinates 337793..338161 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag QDF61_RS01575 Protein ID WP_004174006.1
Coordinates 337575..337796 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDF61_RS01555 (333732) 333732..334658 + 927 WP_033128500.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QDF61_RS01560 (334655) 334655..335932 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
QDF61_RS01565 (335929) 335929..336696 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QDF61_RS01570 (336698) 336698..337411 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QDF61_RS01575 (337575) 337575..337796 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QDF61_RS01580 (337793) 337793..338161 + 369 WP_004174007.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QDF61_RS01585 (338434) 338434..339750 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QDF61_RS01590 (339857) 339857..340744 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QDF61_RS01595 (340741) 340741..341586 + 846 WP_004174009.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QDF61_RS01600 (341588) 341588..342658 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 334655..343395 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(6-116)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13568.97 Da        Isoelectric Point: 8.6410

>T278551 WP_004174007.1 NZ_CP123043:337793-338161 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDLGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT278551 WP_004174006.1 NZ_CP123043:337575-337796 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A486RB10

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References