Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 68469..68708 Replicon plasmid pE22P1
Accession NZ_CP123037
Organism Escherichia coli strain E22

Toxin (Protein)


Gene name srnB Uniprot ID A0A762TWR7
Locus tag QEN54_RS23780 Protein ID WP_023144756.1
Coordinates 68469..68603 (-) Length 45 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 68648..68708 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEN54_RS23755 (64170) 64170..65027 - 858 WP_000130640.1 incFII family plasmid replication initiator RepA -
QEN54_RS23760 (65020) 65020..65094 - 75 WP_031943482.1 RepA leader peptide Tap -
QEN54_RS23765 (65456) 65456..66997 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
QEN54_RS23770 (67012) 67012..67758 + 747 WP_053906593.1 IS21-like element ISEc12 family helper ATPase IstB -
QEN54_RS23775 (67918) 67918..68172 - 255 WP_000083850.1 replication regulatory protein RepA -
QEN54_RS23780 (68469) 68469..68603 - 135 WP_023144756.1 Hok/Gef family protein Toxin
- (68648) 68648..68708 + 61 NuclAT_0 - Antitoxin
- (68648) 68648..68708 + 61 NuclAT_0 - Antitoxin
- (68648) 68648..68708 + 61 NuclAT_0 - Antitoxin
- (68648) 68648..68708 + 61 NuclAT_0 - Antitoxin
QEN54_RS23785 (68675) 68675..68961 - 287 Protein_85 DUF2726 domain-containing protein -
QEN54_RS23790 (69474) 69474..69686 - 213 WP_013023861.1 hypothetical protein -
QEN54_RS23795 (69817) 69817..70377 - 561 WP_000139341.1 fertility inhibition protein FinO -
QEN54_RS23800 (70432) 70432..71178 - 747 WP_000205718.1 conjugal transfer pilus acetylase TraX -
QEN54_RS23805 (71198) 71198..73591 - 2394 Protein_89 conjugative transfer relaxase/helicase TraI -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(B) / sul1 / aadA2 / dfrA12 / blaTEM-1B / sul2 / aph(3'')-Ib / aph(6)-Id / mph(A) / aac(3)-IId / aadA5 / blaNDM-5 / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr - 1..108280 108280


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-44)


Sequences

Toxin        


Download         Length: 45 a.a.        Molecular weight: 4896.90 Da        Isoelectric Point: 7.7209

>T278531 WP_023144756.1 NZ_CP123037:c68603-68469 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Download         Length: 135 bp

Antitoxin


Download         Length: 61 bp

>AT278531 NZ_CP123037:68648-68708 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A762TWR7

Antitoxin

Download structure file

References