Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 68469..68708 | Replicon | plasmid pE22P1 |
| Accession | NZ_CP123037 | ||
| Organism | Escherichia coli strain E22 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | QEN54_RS23780 | Protein ID | WP_023144756.1 |
| Coordinates | 68469..68603 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 68648..68708 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEN54_RS23755 (64170) | 64170..65027 | - | 858 | WP_000130640.1 | incFII family plasmid replication initiator RepA | - |
| QEN54_RS23760 (65020) | 65020..65094 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| QEN54_RS23765 (65456) | 65456..66997 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| QEN54_RS23770 (67012) | 67012..67758 | + | 747 | WP_053906593.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| QEN54_RS23775 (67918) | 67918..68172 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| QEN54_RS23780 (68469) | 68469..68603 | - | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| - (68648) | 68648..68708 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (68648) | 68648..68708 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (68648) | 68648..68708 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (68648) | 68648..68708 | + | 61 | NuclAT_0 | - | Antitoxin |
| QEN54_RS23785 (68675) | 68675..68961 | - | 287 | Protein_85 | DUF2726 domain-containing protein | - |
| QEN54_RS23790 (69474) | 69474..69686 | - | 213 | WP_013023861.1 | hypothetical protein | - |
| QEN54_RS23795 (69817) | 69817..70377 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
| QEN54_RS23800 (70432) | 70432..71178 | - | 747 | WP_000205718.1 | conjugal transfer pilus acetylase TraX | - |
| QEN54_RS23805 (71198) | 71198..73591 | - | 2394 | Protein_89 | conjugative transfer relaxase/helicase TraI | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(B) / sul1 / aadA2 / dfrA12 / blaTEM-1B / sul2 / aph(3'')-Ib / aph(6)-Id / mph(A) / aac(3)-IId / aadA5 / blaNDM-5 / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr | - | 1..108280 | 108280 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T278531 WP_023144756.1 NZ_CP123037:c68603-68469 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT278531 NZ_CP123037:68648-68708 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|