Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1111556..1112283 | Replicon | chromosome |
Accession | NZ_CP123036 | ||
Organism | Escherichia coli strain E22 |
Toxin (Protein)
Gene name | higB | Uniprot ID | J7Q991 |
Locus tag | QEN54_RS05450 | Protein ID | WP_000547564.1 |
Coordinates | 1111556..1111867 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QEN54_RS05455 | Protein ID | WP_000126294.1 |
Coordinates | 1111864..1112283 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN54_RS05420 (1106698) | 1106698..1108407 | + | 1710 | WP_001288134.1 | formate hydrogenlyase subunit HycE | - |
QEN54_RS05425 (1108417) | 1108417..1108959 | + | 543 | WP_000493792.1 | formate hydrogenlyase subunit HycF | - |
QEN54_RS05430 (1108959) | 1108959..1109726 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
QEN54_RS05435 (1109723) | 1109723..1110133 | + | 411 | WP_001291921.1 | formate hydrogenlyase assembly protein HycH | - |
QEN54_RS05440 (1110126) | 1110126..1110596 | + | 471 | WP_060621146.1 | hydrogenase maturation peptidase HycI | - |
QEN54_RS05445 (1110621) | 1110621..1111382 | + | 762 | WP_001026446.1 | hypothetical protein | - |
QEN54_RS05450 (1111556) | 1111556..1111867 | + | 312 | WP_000547564.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
QEN54_RS05455 (1111864) | 1111864..1112283 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
QEN54_RS05460 (1112397) | 1112397..1113821 | - | 1425 | WP_000110363.1 | 6-phospho-beta-glucosidase AscB | - |
QEN54_RS05465 (1113830) | 1113830..1115287 | - | 1458 | WP_001107861.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
QEN54_RS05470 (1115547) | 1115547..1116557 | + | 1011 | WP_001392554.1 | DNA-binding transcriptional regulator AscG | - |
QEN54_RS05475 (1116706) | 1116706..1117233 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12426.13 Da Isoelectric Point: 9.7248
>T278518 WP_000547564.1 NZ_CP123036:1111556-1111867 [Escherichia coli]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT278518 WP_000126294.1 NZ_CP123036:1111864-1112283 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|