Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 44333..44572 Replicon plasmid p20-20P2
Accession NZ_CP123031
Organism Escherichia coli strain 20-20

Toxin (Protein)


Gene name srnB Uniprot ID A0A762TWR7
Locus tag QEN57_RS23925 Protein ID WP_023144756.1
Coordinates 44333..44467 (-) Length 45 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 44512..44572 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEN57_RS23900 (40034) 40034..40891 - 858 WP_000130640.1 incFII family plasmid replication initiator RepA -
QEN57_RS23905 (40884) 40884..40958 - 75 WP_031943482.1 RepA leader peptide Tap -
QEN57_RS23910 (41320) 41320..42861 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
QEN57_RS23915 (42876) 42876..43622 + 747 WP_053906593.1 IS21-like element ISEc12 family helper ATPase IstB -
QEN57_RS23920 (43782) 43782..44036 - 255 WP_000083850.1 replication regulatory protein RepA -
QEN57_RS23925 (44333) 44333..44467 - 135 WP_023144756.1 Hok/Gef family protein Toxin
- (44512) 44512..44572 + 61 NuclAT_0 - Antitoxin
- (44512) 44512..44572 + 61 NuclAT_0 - Antitoxin
- (44512) 44512..44572 + 61 NuclAT_0 - Antitoxin
- (44512) 44512..44572 + 61 NuclAT_0 - Antitoxin
QEN57_RS23930 (44539) 44539..44825 - 287 Protein_58 DUF2726 domain-containing protein -
QEN57_RS23935 (45338) 45338..45550 - 213 WP_013023861.1 hypothetical protein -
QEN57_RS23940 (45681) 45681..46241 - 561 WP_000139341.1 fertility inhibition protein FinO -
QEN57_RS23945 (46296) 46296..47042 - 747 WP_000205718.1 conjugal transfer pilus acetylase TraX -
QEN57_RS23950 (47062) 47062..49455 - 2394 Protein_62 conjugative transfer relaxase/helicase TraI -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(B) / sul1 / qacE / aadA2 / dfrA12 / blaNDM-5 / blaTEM-1B / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr - 1..84132 84132


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-44)


Sequences

Toxin        


Download         Length: 45 a.a.        Molecular weight: 4896.90 Da        Isoelectric Point: 7.7209

>T278505 WP_023144756.1 NZ_CP123031:c44467-44333 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Download         Length: 135 bp

Antitoxin


Download         Length: 61 bp

>AT278505 NZ_CP123031:44512-44572 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A762TWR7

Antitoxin

Download structure file

References