Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1085056..1085783 | Replicon | chromosome |
Accession | NZ_CP123029 | ||
Organism | Escherichia coli strain 20-20 |
Toxin (Protein)
Gene name | higB | Uniprot ID | J7Q991 |
Locus tag | QEN57_RS05290 | Protein ID | WP_000547564.1 |
Coordinates | 1085056..1085367 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QEN57_RS05295 | Protein ID | WP_000126294.1 |
Coordinates | 1085364..1085783 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN57_RS05260 (1080198) | 1080198..1081907 | + | 1710 | WP_001288134.1 | formate hydrogenlyase subunit HycE | - |
QEN57_RS05265 (1081917) | 1081917..1082459 | + | 543 | WP_000493792.1 | formate hydrogenlyase subunit HycF | - |
QEN57_RS05270 (1082459) | 1082459..1083226 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
QEN57_RS05275 (1083223) | 1083223..1083633 | + | 411 | WP_001291921.1 | formate hydrogenlyase assembly protein HycH | - |
QEN57_RS05280 (1083626) | 1083626..1084096 | + | 471 | WP_060621146.1 | hydrogenase maturation peptidase HycI | - |
QEN57_RS05285 (1084121) | 1084121..1084882 | + | 762 | WP_001026446.1 | hypothetical protein | - |
QEN57_RS05290 (1085056) | 1085056..1085367 | + | 312 | WP_000547564.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
QEN57_RS05295 (1085364) | 1085364..1085783 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
QEN57_RS05300 (1085897) | 1085897..1087321 | - | 1425 | WP_000110363.1 | 6-phospho-beta-glucosidase AscB | - |
QEN57_RS05305 (1087330) | 1087330..1088787 | - | 1458 | WP_001107861.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
QEN57_RS05310 (1089047) | 1089047..1090057 | + | 1011 | WP_001392554.1 | DNA-binding transcriptional regulator AscG | - |
QEN57_RS05315 (1090206) | 1090206..1090733 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12426.13 Da Isoelectric Point: 9.7248
>T278491 WP_000547564.1 NZ_CP123029:1085056-1085367 [Escherichia coli]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT278491 WP_000126294.1 NZ_CP123029:1085364-1085783 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|