Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 743097..743790 | Replicon | chromosome |
Accession | NZ_CP123029 | ||
Organism | Escherichia coli strain 20-20 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | U9ZN09 |
Locus tag | QEN57_RS03605 | Protein ID | WP_000415585.1 |
Coordinates | 743097..743393 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | QEN57_RS03610 | Protein ID | WP_000650107.1 |
Coordinates | 743395..743790 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN57_RS03570 (738231) | 738231..738710 | + | 480 | WP_000065332.1 | Hcp family type VI secretion system effector | - |
QEN57_RS03575 (738713) | 738713..739423 | + | 711 | WP_000834030.1 | hypothetical protein | - |
QEN57_RS03580 (739430) | 739430..739762 | + | 333 | WP_000914690.1 | DUF2645 family protein | - |
QEN57_RS03585 (739808) | 739808..741157 | - | 1350 | WP_000673358.1 | quorum sensing histidine kinase QseC | - |
QEN57_RS03590 (741154) | 741154..741813 | - | 660 | WP_001221502.1 | quorum sensing response regulator transcription factor QseB | - |
QEN57_RS03595 (741965) | 741965..742357 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
QEN57_RS03600 (742410) | 742410..742892 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
QEN57_RS03605 (743097) | 743097..743393 | + | 297 | WP_000415585.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
QEN57_RS03610 (743395) | 743395..743790 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
QEN57_RS03615 (743923) | 743923..745530 | + | 1608 | WP_001375094.1 | ABC transporter substrate-binding protein | - |
QEN57_RS03620 (745668) | 745668..747926 | + | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11261.99 Da Isoelectric Point: 8.9070
>T278488 WP_000415585.1 NZ_CP123029:743097-743393 [Escherichia coli]
MEKRTPHTRLSQVKKLVNTGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNTGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT278488 WP_000650107.1 NZ_CP123029:743395-743790 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|