Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 629558..630357 | Replicon | chromosome |
Accession | NZ_CP123029 | ||
Organism | Escherichia coli strain 20-20 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | QEN57_RS03055 | Protein ID | WP_000347251.1 |
Coordinates | 629558..630022 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | QEN57_RS03060 | Protein ID | WP_001307405.1 |
Coordinates | 630022..630357 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN57_RS03025 (624559) | 624559..624993 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
QEN57_RS03030 (625011) | 625011..625889 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
QEN57_RS03035 (625879) | 625879..626658 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
QEN57_RS03040 (626669) | 626669..627142 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
QEN57_RS03045 (627165) | 627165..628445 | - | 1281 | WP_000681903.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
QEN57_RS03050 (628694) | 628694..629503 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
QEN57_RS03055 (629558) | 629558..630022 | - | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
QEN57_RS03060 (630022) | 630022..630357 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
QEN57_RS03065 (630506) | 630506..632077 | - | 1572 | WP_001273761.1 | galactarate dehydratase | - |
QEN57_RS03070 (632452) | 632452..633786 | + | 1335 | WP_000599652.1 | galactarate/glucarate/glycerate transporter GarP | - |
QEN57_RS03075 (633802) | 633802..634572 | + | 771 | WP_001058214.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T278487 WP_000347251.1 NZ_CP123029:c630022-629558 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJ20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |