Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 60791..61030 Replicon plasmid p20-16P1
Accession NZ_CP123025
Organism Escherichia coli strain 20-16

Toxin (Protein)


Gene name srnB Uniprot ID A0A762TWR7
Locus tag QEN53_RS23820 Protein ID WP_023144756.1
Coordinates 60791..60925 (-) Length 45 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 60970..61030 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEN53_RS23795 (56492) 56492..57349 - 858 WP_000130640.1 incFII family plasmid replication initiator RepA -
QEN53_RS23800 (57342) 57342..57416 - 75 WP_031943482.1 RepA leader peptide Tap -
QEN53_RS23805 (57778) 57778..59319 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
QEN53_RS23810 (59334) 59334..60080 + 747 WP_053906593.1 IS21-like element ISEc12 family helper ATPase IstB -
QEN53_RS23815 (60240) 60240..60494 - 255 WP_000083850.1 replication regulatory protein RepA -
QEN53_RS23820 (60791) 60791..60925 - 135 WP_023144756.1 Hok/Gef family protein Toxin
- (60970) 60970..61030 + 61 NuclAT_0 - Antitoxin
- (60970) 60970..61030 + 61 NuclAT_0 - Antitoxin
- (60970) 60970..61030 + 61 NuclAT_0 - Antitoxin
- (60970) 60970..61030 + 61 NuclAT_0 - Antitoxin
QEN53_RS23825 (60997) 60997..61283 - 287 Protein_75 DUF2726 domain-containing protein -
QEN53_RS23830 (61796) 61796..62008 - 213 WP_013023861.1 hypothetical protein -
QEN53_RS23835 (62139) 62139..62699 - 561 WP_000139341.1 fertility inhibition protein FinO -
QEN53_RS23840 (62754) 62754..63500 - 747 WP_000205718.1 conjugal transfer pilus acetylase TraX -
QEN53_RS23845 (63520) 63520..65913 - 2394 Protein_79 conjugative transfer relaxase/helicase TraI -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(B) / sul1 / qacE / aadA2 / dfrA12 / blaNDM-5 / aadA5 / mph(A) / aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1B / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr - 1..100602 100602


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-44)


Sequences

Toxin        


Download         Length: 45 a.a.        Molecular weight: 4896.90 Da        Isoelectric Point: 7.7209

>T278479 WP_023144756.1 NZ_CP123025:c60925-60791 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Download         Length: 135 bp

Antitoxin


Download         Length: 61 bp

>AT278479 NZ_CP123025:60970-61030 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A762TWR7

Antitoxin

Download structure file

References