Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 44085..44324 Replicon plasmid p19-7P2
Accession NZ_CP123019
Organism Escherichia coli strain 19-7

Toxin (Protein)


Gene name srnB Uniprot ID A0A762TWR7
Locus tag QEN55_RS24170 Protein ID WP_023144756.1
Coordinates 44085..44219 (-) Length 45 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 44264..44324 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEN55_RS24145 (39786) 39786..40643 - 858 WP_000130640.1 incFII family plasmid replication initiator RepA -
QEN55_RS24150 (40636) 40636..40710 - 75 WP_031943482.1 RepA leader peptide Tap -
QEN55_RS24155 (41072) 41072..42613 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
QEN55_RS24160 (42628) 42628..43374 + 747 WP_053906593.1 IS21-like element ISEc12 family helper ATPase IstB -
QEN55_RS24165 (43534) 43534..43788 - 255 WP_000083850.1 replication regulatory protein RepA -
QEN55_RS24170 (44085) 44085..44219 - 135 WP_023144756.1 Hok/Gef family protein Toxin
- (44264) 44264..44324 + 61 NuclAT_0 - Antitoxin
- (44264) 44264..44324 + 61 NuclAT_0 - Antitoxin
- (44264) 44264..44324 + 61 NuclAT_0 - Antitoxin
- (44264) 44264..44324 + 61 NuclAT_0 - Antitoxin
QEN55_RS24175 (44291) 44291..44577 - 287 Protein_57 DUF2726 domain-containing protein -
QEN55_RS24180 (45090) 45090..45302 - 213 WP_013023861.1 hypothetical protein -
QEN55_RS24185 (45433) 45433..45993 - 561 WP_000139341.1 fertility inhibition protein FinO -
QEN55_RS24190 (46048) 46048..46794 - 747 WP_000205736.1 conjugal transfer pilus acetylase TraX -
QEN55_RS24195 (46814) 46814..49207 - 2394 Protein_61 conjugative transfer relaxase/helicase TraI -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(B) / sul1 / qacE / aadA2 / dfrA12 / blaNDM-5 / aadA5 / blaTEM-1B / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr - 1..83900 83900


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-44)


Sequences

Toxin        


Download         Length: 45 a.a.        Molecular weight: 4896.90 Da        Isoelectric Point: 7.7209

>T278453 WP_023144756.1 NZ_CP123019:c44219-44085 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Download         Length: 135 bp

Antitoxin


Download         Length: 61 bp

>AT278453 NZ_CP123019:44264-44324 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A762TWR7

Antitoxin

Download structure file

References