Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 772298..772991 | Replicon | chromosome |
Accession | NZ_CP123017 | ||
Organism | Escherichia coli strain 19-7 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | U9ZN09 |
Locus tag | QEN55_RS03785 | Protein ID | WP_000415585.1 |
Coordinates | 772298..772594 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | QEN55_RS03790 | Protein ID | WP_000650107.1 |
Coordinates | 772596..772991 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN55_RS03750 (767432) | 767432..767911 | + | 480 | WP_000065332.1 | Hcp family type VI secretion system effector | - |
QEN55_RS03755 (767914) | 767914..768624 | + | 711 | WP_000834030.1 | hypothetical protein | - |
QEN55_RS03760 (768631) | 768631..768963 | + | 333 | WP_000914690.1 | DUF2645 family protein | - |
QEN55_RS03765 (769009) | 769009..770358 | - | 1350 | WP_000673358.1 | quorum sensing histidine kinase QseC | - |
QEN55_RS03770 (770355) | 770355..771014 | - | 660 | WP_001221502.1 | quorum sensing response regulator transcription factor QseB | - |
QEN55_RS03775 (771166) | 771166..771558 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
QEN55_RS03780 (771611) | 771611..772093 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
QEN55_RS03785 (772298) | 772298..772594 | + | 297 | WP_000415585.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
QEN55_RS03790 (772596) | 772596..772991 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
QEN55_RS03795 (773124) | 773124..774731 | + | 1608 | WP_001375094.1 | ABC transporter substrate-binding protein | - |
QEN55_RS03800 (774869) | 774869..777127 | + | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11261.99 Da Isoelectric Point: 8.9070
>T278437 WP_000415585.1 NZ_CP123017:772298-772594 [Escherichia coli]
MEKRTPHTRLSQVKKLVNTGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNTGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT278437 WP_000650107.1 NZ_CP123017:772596-772991 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|