Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 68047..68286 | Replicon | plasmid p18-4P1 |
| Accession | NZ_CP123014 | ||
| Organism | Escherichia coli strain 18-4 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | QEN56_RS23885 | Protein ID | WP_023144756.1 |
| Coordinates | 68047..68181 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 68226..68286 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEN56_RS23860 (63748) | 63748..64605 | - | 858 | WP_000130640.1 | incFII family plasmid replication initiator RepA | - |
| QEN56_RS23865 (64598) | 64598..64672 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| QEN56_RS23870 (65034) | 65034..66575 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| QEN56_RS23875 (66590) | 66590..67336 | + | 747 | WP_053906593.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| QEN56_RS23880 (67496) | 67496..67750 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| QEN56_RS23885 (68047) | 68047..68181 | - | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| - (68226) | 68226..68286 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (68226) | 68226..68286 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (68226) | 68226..68286 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (68226) | 68226..68286 | + | 61 | NuclAT_0 | - | Antitoxin |
| QEN56_RS23890 (68253) | 68253..68539 | - | 287 | Protein_85 | DUF2726 domain-containing protein | - |
| QEN56_RS23895 (69052) | 69052..69264 | - | 213 | WP_013023861.1 | hypothetical protein | - |
| QEN56_RS23900 (69395) | 69395..69955 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
| QEN56_RS23905 (70010) | 70010..70756 | - | 747 | WP_000205718.1 | conjugal transfer pilus acetylase TraX | - |
| QEN56_RS23910 (70776) | 70776..73169 | - | 2394 | Protein_89 | conjugative transfer relaxase/helicase TraI | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(B) / sul1 / qacE / aadA2 / dfrA12 / blaNDM-5 / blaTEM-1B / aac(3)-IId / mph(A) / aph(6)-Id / aph(3'')-Ib / sul2 / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr | - | 1..107858 | 107858 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T278427 WP_023144756.1 NZ_CP123014:c68181-68047 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT278427 NZ_CP123014:68226-68286 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|