Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 68047..68286 Replicon plasmid p18-4P1
Accession NZ_CP123014
Organism Escherichia coli strain 18-4

Toxin (Protein)


Gene name srnB Uniprot ID A0A762TWR7
Locus tag QEN56_RS23885 Protein ID WP_023144756.1
Coordinates 68047..68181 (-) Length 45 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 68226..68286 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEN56_RS23860 (63748) 63748..64605 - 858 WP_000130640.1 incFII family plasmid replication initiator RepA -
QEN56_RS23865 (64598) 64598..64672 - 75 WP_031943482.1 RepA leader peptide Tap -
QEN56_RS23870 (65034) 65034..66575 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
QEN56_RS23875 (66590) 66590..67336 + 747 WP_053906593.1 IS21-like element ISEc12 family helper ATPase IstB -
QEN56_RS23880 (67496) 67496..67750 - 255 WP_000083850.1 replication regulatory protein RepA -
QEN56_RS23885 (68047) 68047..68181 - 135 WP_023144756.1 Hok/Gef family protein Toxin
- (68226) 68226..68286 + 61 NuclAT_0 - Antitoxin
- (68226) 68226..68286 + 61 NuclAT_0 - Antitoxin
- (68226) 68226..68286 + 61 NuclAT_0 - Antitoxin
- (68226) 68226..68286 + 61 NuclAT_0 - Antitoxin
QEN56_RS23890 (68253) 68253..68539 - 287 Protein_85 DUF2726 domain-containing protein -
QEN56_RS23895 (69052) 69052..69264 - 213 WP_013023861.1 hypothetical protein -
QEN56_RS23900 (69395) 69395..69955 - 561 WP_000139341.1 fertility inhibition protein FinO -
QEN56_RS23905 (70010) 70010..70756 - 747 WP_000205718.1 conjugal transfer pilus acetylase TraX -
QEN56_RS23910 (70776) 70776..73169 - 2394 Protein_89 conjugative transfer relaxase/helicase TraI -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(B) / sul1 / qacE / aadA2 / dfrA12 / blaNDM-5 / blaTEM-1B / aac(3)-IId / mph(A) / aph(6)-Id / aph(3'')-Ib / sul2 / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr - 1..107858 107858


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-44)


Sequences

Toxin        


Download         Length: 45 a.a.        Molecular weight: 4896.90 Da        Isoelectric Point: 7.7209

>T278427 WP_023144756.1 NZ_CP123014:c68181-68047 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Download         Length: 135 bp

Antitoxin


Download         Length: 61 bp

>AT278427 NZ_CP123014:68226-68286 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A762TWR7

Antitoxin

Download structure file

References