Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1111669..1112396 | Replicon | chromosome |
| Accession | NZ_CP123013 | ||
| Organism | Escherichia coli strain 18-4 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | J7Q991 |
| Locus tag | QEN56_RS05445 | Protein ID | WP_000547564.1 |
| Coordinates | 1111669..1111980 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QEN56_RS05450 | Protein ID | WP_000126294.1 |
| Coordinates | 1111977..1112396 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEN56_RS05415 (1106811) | 1106811..1108520 | + | 1710 | WP_001288134.1 | formate hydrogenlyase subunit HycE | - |
| QEN56_RS05420 (1108530) | 1108530..1109072 | + | 543 | WP_000493792.1 | formate hydrogenlyase subunit HycF | - |
| QEN56_RS05425 (1109072) | 1109072..1109839 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
| QEN56_RS05430 (1109836) | 1109836..1110246 | + | 411 | WP_001291921.1 | formate hydrogenlyase assembly protein HycH | - |
| QEN56_RS05435 (1110239) | 1110239..1110709 | + | 471 | WP_060621146.1 | hydrogenase maturation peptidase HycI | - |
| QEN56_RS05440 (1110734) | 1110734..1111495 | + | 762 | WP_001026446.1 | hypothetical protein | - |
| QEN56_RS05445 (1111669) | 1111669..1111980 | + | 312 | WP_000547564.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| QEN56_RS05450 (1111977) | 1111977..1112396 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
| QEN56_RS05455 (1112510) | 1112510..1113934 | - | 1425 | WP_000110363.1 | 6-phospho-beta-glucosidase AscB | - |
| QEN56_RS05460 (1113943) | 1113943..1115400 | - | 1458 | WP_001107861.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| QEN56_RS05465 (1115660) | 1115660..1116670 | + | 1011 | WP_001392554.1 | DNA-binding transcriptional regulator AscG | - |
| QEN56_RS05470 (1116819) | 1116819..1117346 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12426.13 Da Isoelectric Point: 9.7248
>T278414 WP_000547564.1 NZ_CP123013:1111669-1111980 [Escherichia coli]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT278414 WP_000126294.1 NZ_CP123013:1111977-1112396 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|