Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
| Location | 4653922..4654463 | Replicon | chromosome |
| Accession | NZ_CP123009 | ||
| Organism | Escherichia coli O155 strain NWU_3 | ||
Toxin (Protein)
| Gene name | yafQ | Uniprot ID | U9XPG0 |
| Locus tag | QEN28_RS22565 | Protein ID | WP_000615976.1 |
| Coordinates | 4654185..4654463 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | dinJ | Uniprot ID | S1EWQ0 |
| Locus tag | QEN28_RS22560 | Protein ID | WP_000729704.1 |
| Coordinates | 4653922..4654182 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEN28_RS22535 (4649705) | 4649705..4650490 | - | 786 | WP_000207575.1 | putative lateral flagellar export/assembly protein LafU | - |
| QEN28_RS22540 (4650462) | 4650462..4652174 | + | 1713 | Protein_4438 | flagellar biosynthesis protein FlhA | - |
| QEN28_RS22545 (4652279) | 4652279..4652557 | + | 279 | WP_000598760.1 | type II toxin-antitoxin system HicA family toxin | - |
| QEN28_RS22550 (4652550) | 4652550..4652906 | + | 357 | WP_001030483.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| QEN28_RS22555 (4652963) | 4652963..4653736 | - | 774 | WP_000543895.1 | C40 family peptidase | - |
| QEN28_RS22560 (4653922) | 4653922..4654182 | + | 261 | WP_000729704.1 | type II toxin-antitoxin system antitoxin DinJ | Antitoxin |
| QEN28_RS22565 (4654185) | 4654185..4654463 | + | 279 | WP_000615976.1 | type II toxin-antitoxin system mRNA interferase toxin YafQ | Toxin |
| QEN28_RS22570 (4654619) | 4654619..4655359 | + | 741 | WP_001225679.1 | peptidoglycan meso-diaminopimelic acid protein amidase | - |
| QEN28_RS22575 (4655330) | 4655330..4656097 | - | 768 | WP_000333380.1 | class II glutamine amidotransferase | - |
| QEN28_RS22580 (4656303) | 4656303..4656881 | - | 579 | WP_000284050.1 | D-sedoheptulose 7-phosphate isomerase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10800.59 Da Isoelectric Point: 10.0702
>T278406 WP_000615976.1 NZ_CP123009:4654185-4654463 [Escherichia coli O155]
MIQRDIEYSGQFSKDVKLAQKRHKDMNKLKYLMTLLINNALPLPAVYKDHPLQGSWKGYRDAHVEPDWILIYKLTDKLLR
FERTGTHAALFG
MIQRDIEYSGQFSKDVKLAQKRHKDMNKLKYLMTLLINNALPLPAVYKDHPLQGSWKGYRDAHVEPDWILIYKLTDKLLR
FERTGTHAALFG
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | U9XPG0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 4ML0 | |
| AlphaFold DB | A0A0E0Y6Z6 |