Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-ralA/- |
| Location | 4115858..4116279 | Replicon | chromosome |
| Accession | NZ_CP123009 | ||
| Organism | Escherichia coli O155 strain NWU_3 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QEN28_RS19720 | Protein ID | WP_096937776.1 |
| Coordinates | 4116154..4116279 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 4115858..4116056 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEN28_RS19685 (4110961) | 4110961..4111470 | - | 510 | WP_071600123.1 | hypothetical protein | - |
| QEN28_RS19690 (4111788) | 4111788..4112327 | + | 540 | WP_000290801.1 | single-stranded DNA-binding protein | - |
| QEN28_RS19695 (4112384) | 4112384..4112617 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
| QEN28_RS19700 (4112683) | 4112683..4114641 | + | 1959 | WP_000117173.1 | ParB/RepB/Spo0J family partition protein | - |
| QEN28_RS19705 (4114696) | 4114696..4115130 | + | 435 | WP_000845928.1 | conjugation system SOS inhibitor PsiB | - |
| QEN28_RS19710 (4115127) | 4115127..4115889 | + | 763 | Protein_3877 | plasmid SOS inhibition protein A | - |
| - (4115858) | 4115858..4116056 | + | 199 | NuclAT_1 | - | Antitoxin |
| - (4115858) | 4115858..4116056 | + | 199 | NuclAT_1 | - | Antitoxin |
| - (4115858) | 4115858..4116056 | + | 199 | NuclAT_1 | - | Antitoxin |
| - (4115858) | 4115858..4116056 | + | 199 | NuclAT_1 | - | Antitoxin |
| QEN28_RS19715 (4116063) | 4116063..4116212 | + | 150 | Protein_3878 | DUF5431 family protein | - |
| QEN28_RS19720 (4116154) | 4116154..4116279 | + | 126 | WP_096937776.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QEN28_RS19725 (4116580) | 4116580..4116876 | - | 297 | Protein_3880 | hypothetical protein | - |
| QEN28_RS19730 (4116946) | 4116946..4117152 | + | 207 | WP_000547965.1 | hypothetical protein | - |
| QEN28_RS19735 (4117177) | 4117177..4117464 | + | 288 | WP_000107542.1 | hypothetical protein | - |
| QEN28_RS19740 (4117583) | 4117583..4118404 | + | 822 | WP_001234417.1 | DUF932 domain-containing protein | - |
| QEN28_RS19745 (4118700) | 4118700..4119302 | - | 603 | WP_000243701.1 | transglycosylase SLT domain-containing protein | - |
| QEN28_RS19750 (4119624) | 4119624..4120007 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| QEN28_RS19755 (4120197) | 4120197..4120883 | + | 687 | WP_000332492.1 | PAS domain-containing protein | - |
| QEN28_RS19760 (4120977) | 4120977..4121204 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 4090602..4136494 | 45892 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4806.72 Da Isoelectric Point: 8.4890
>T278402 WP_096937776.1 NZ_CP123009:4116154-4116279 [Escherichia coli O155]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 199 bp
>AT278402 NZ_CP123009:4115858-4116056 [Escherichia coli O155]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|