Detailed information of TA system TA278402

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-ralA/-
• Location: 4115858..4116279
• Replicon: chromosome
• Accession: NZ_CP123009
• Organism: Escherichia coli O155 strain NWU_3

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QEN28_RS19720
• Protein ID: WP_096937776.1
• Coordinates: 4116154..4116279 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	ralA
Locus tag	-
Coordinates	4115858..4116056 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QEN28_RS19685 (4110961)	4110961..4111470	-	510	WP_071600123.1	hypothetical protein	-
QEN28_RS19690 (4111788)	4111788..4112327	+	540	WP_000290801.1	single-stranded DNA-binding protein	-
QEN28_RS19695 (4112384)	4112384..4112617	+	234	WP_000005990.1	DUF905 family protein	-
QEN28_RS19700 (4112683)	4112683..4114641	+	1959	WP_000117173.1	ParB/RepB/Spo0J family partition protein	-
QEN28_RS19705 (4114696)	4114696..4115130	+	435	WP_000845928.1	conjugation system SOS inhibitor PsiB	-
QEN28_RS19710 (4115127)	4115127..4115889	+	763	Protein_3877	plasmid SOS inhibition protein A	-
- (4115858)	4115858..4116056	+	199	NuclAT_1	-	Antitoxin
- (4115858)	4115858..4116056	+	199	NuclAT_1	-	Antitoxin
- (4115858)	4115858..4116056	+	199	NuclAT_1	-	Antitoxin
- (4115858)	4115858..4116056	+	199	NuclAT_1	-	Antitoxin
QEN28_RS19715 (4116063)	4116063..4116212	+	150	Protein_3878	DUF5431 family protein	-
QEN28_RS19720 (4116154)	4116154..4116279	+	126	WP_096937776.1	type I toxin-antitoxin system Hok family toxin	Toxin
QEN28_RS19725 (4116580)	4116580..4116876	-	297	Protein_3880	hypothetical protein	-
QEN28_RS19730 (4116946)	4116946..4117152	+	207	WP_000547965.1	hypothetical protein	-
QEN28_RS19735 (4117177)	4117177..4117464	+	288	WP_000107542.1	hypothetical protein	-
QEN28_RS19740 (4117583)	4117583..4118404	+	822	WP_001234417.1	DUF932 domain-containing protein	-
QEN28_RS19745 (4118700)	4118700..4119302	-	603	WP_000243701.1	transglycosylase SLT domain-containing protein	-
QEN28_RS19750 (4119624)	4119624..4120007	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QEN28_RS19755 (4120197)	4120197..4120883	+	687	WP_000332492.1	PAS domain-containing protein	-
QEN28_RS19760 (4120977)	4120977..4121204	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Integrative and Conjugative Element	-	-	4090602..4136494	45892

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4806.72 Da
• Isoelectric Point: 8.4890

>T278402 WP_096937776.1 NZ_CP123009:4116154-4116279 [Escherichia coli O155]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 199 bp

>AT278402 NZ_CP123009:4115858-4116056 [Escherichia coli O155]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC

Structures

Antitoxin