Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 3951468..3952070 | Replicon | chromosome |
Accession | NZ_CP123009 | ||
Organism | Escherichia coli O155 strain NWU_3 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | QEN28_RS18950 | Protein ID | WP_000897305.1 |
Coordinates | 3951759..3952070 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QEN28_RS18945 | Protein ID | WP_000356397.1 |
Coordinates | 3951468..3951758 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN28_RS18920 (3947393) | 3947393..3948295 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
QEN28_RS18925 (3948292) | 3948292..3948927 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
QEN28_RS18930 (3948924) | 3948924..3949853 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
QEN28_RS18935 (3950183) | 3950183..3950425 | - | 243 | WP_001087409.1 | protein YiiF | - |
QEN28_RS18940 (3950645) | 3950645..3950863 | - | 219 | WP_001315930.1 | CopG family transcriptional regulator | - |
QEN28_RS18945 (3951468) | 3951468..3951758 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
QEN28_RS18950 (3951759) | 3951759..3952070 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
QEN28_RS18955 (3952299) | 3952299..3953207 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
QEN28_RS18960 (3953271) | 3953271..3954212 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
QEN28_RS18965 (3954257) | 3954257..3954694 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
QEN28_RS18970 (3954691) | 3954691..3955563 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
QEN28_RS18975 (3955557) | 3955557..3956156 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
QEN28_RS18980 (3956255) | 3956255..3957040 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T278400 WP_000897305.1 NZ_CP123009:c3952070-3951759 [Escherichia coli O155]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|