Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1327742..1327962 Replicon chromosome
Accession NZ_CP123009
Organism Escherichia coli O155 strain NWU_3

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag QEN28_RS06550 Protein ID WP_000170965.1
Coordinates 1327855..1327962 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1327742..1327808 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEN28_RS06525 1323021..1324415 - 1395 WP_000086201.1 inverse autotransporter invasin YchO -
QEN28_RS06530 1324600..1324953 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
QEN28_RS06535 1324997..1325692 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
QEN28_RS06540 1325850..1326080 - 231 WP_001146442.1 putative cation transport regulator ChaB -
QEN28_RS06545 1326350..1327450 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 1327742..1327808 - 67 - - Antitoxin
QEN28_RS06550 1327855..1327962 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1328275..1328338 - 64 NuclAT_36 - -
- 1328275..1328338 - 64 NuclAT_36 - -
- 1328275..1328338 - 64 NuclAT_36 - -
- 1328275..1328338 - 64 NuclAT_36 - -
- 1328275..1328338 - 64 NuclAT_39 - -
- 1328275..1328338 - 64 NuclAT_39 - -
- 1328275..1328338 - 64 NuclAT_39 - -
- 1328275..1328338 - 64 NuclAT_39 - -
- 1328275..1328338 - 64 NuclAT_42 - -
- 1328275..1328338 - 64 NuclAT_42 - -
- 1328275..1328338 - 64 NuclAT_42 - -
- 1328275..1328338 - 64 NuclAT_42 - -
- 1328275..1328338 - 64 NuclAT_45 - -
- 1328275..1328338 - 64 NuclAT_45 - -
- 1328275..1328338 - 64 NuclAT_45 - -
- 1328275..1328338 - 64 NuclAT_45 - -
- 1328275..1328338 - 64 NuclAT_48 - -
- 1328275..1328338 - 64 NuclAT_48 - -
- 1328275..1328338 - 64 NuclAT_48 - -
- 1328275..1328338 - 64 NuclAT_48 - -
- 1328275..1328338 - 64 NuclAT_51 - -
- 1328275..1328338 - 64 NuclAT_51 - -
- 1328275..1328338 - 64 NuclAT_51 - -
- 1328275..1328338 - 64 NuclAT_51 - -
- 1328276..1328338 - 63 NuclAT_53 - -
- 1328276..1328338 - 63 NuclAT_53 - -
- 1328276..1328338 - 63 NuclAT_53 - -
- 1328276..1328338 - 63 NuclAT_53 - -
- 1328277..1328338 - 62 NuclAT_18 - -
- 1328277..1328338 - 62 NuclAT_18 - -
- 1328277..1328338 - 62 NuclAT_18 - -
- 1328277..1328338 - 62 NuclAT_18 - -
- 1328277..1328338 - 62 NuclAT_21 - -
- 1328277..1328338 - 62 NuclAT_21 - -
- 1328277..1328338 - 62 NuclAT_21 - -
- 1328277..1328338 - 62 NuclAT_21 - -
- 1328277..1328338 - 62 NuclAT_24 - -
- 1328277..1328338 - 62 NuclAT_24 - -
- 1328277..1328338 - 62 NuclAT_24 - -
- 1328277..1328338 - 62 NuclAT_24 - -
- 1328277..1328338 - 62 NuclAT_27 - -
- 1328277..1328338 - 62 NuclAT_27 - -
- 1328277..1328338 - 62 NuclAT_27 - -
- 1328277..1328338 - 62 NuclAT_27 - -
- 1328277..1328338 - 62 NuclAT_30 - -
- 1328277..1328338 - 62 NuclAT_30 - -
- 1328277..1328338 - 62 NuclAT_30 - -
- 1328277..1328338 - 62 NuclAT_30 - -
- 1328277..1328338 - 62 NuclAT_33 - -
- 1328277..1328338 - 62 NuclAT_33 - -
- 1328277..1328338 - 62 NuclAT_33 - -
- 1328277..1328338 - 62 NuclAT_33 - -
QEN28_RS06555 1328391..1328498 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1328811..1328876 - 66 NuclAT_35 - -
- 1328811..1328876 - 66 NuclAT_35 - -
- 1328811..1328876 - 66 NuclAT_35 - -
- 1328811..1328876 - 66 NuclAT_35 - -
- 1328811..1328876 - 66 NuclAT_38 - -
- 1328811..1328876 - 66 NuclAT_38 - -
- 1328811..1328876 - 66 NuclAT_38 - -
- 1328811..1328876 - 66 NuclAT_38 - -
- 1328811..1328876 - 66 NuclAT_41 - -
- 1328811..1328876 - 66 NuclAT_41 - -
- 1328811..1328876 - 66 NuclAT_41 - -
- 1328811..1328876 - 66 NuclAT_41 - -
- 1328811..1328876 - 66 NuclAT_44 - -
- 1328811..1328876 - 66 NuclAT_44 - -
- 1328811..1328876 - 66 NuclAT_44 - -
- 1328811..1328876 - 66 NuclAT_44 - -
- 1328811..1328876 - 66 NuclAT_47 - -
- 1328811..1328876 - 66 NuclAT_47 - -
- 1328811..1328876 - 66 NuclAT_47 - -
- 1328811..1328876 - 66 NuclAT_47 - -
- 1328811..1328876 - 66 NuclAT_50 - -
- 1328811..1328876 - 66 NuclAT_50 - -
- 1328811..1328876 - 66 NuclAT_50 - -
- 1328811..1328876 - 66 NuclAT_50 - -
- 1328812..1328878 - 67 NuclAT_52 - -
- 1328812..1328878 - 67 NuclAT_52 - -
- 1328812..1328878 - 67 NuclAT_52 - -
- 1328812..1328878 - 67 NuclAT_52 - -
- 1328813..1328876 - 64 NuclAT_17 - -
- 1328813..1328876 - 64 NuclAT_17 - -
- 1328813..1328876 - 64 NuclAT_17 - -
- 1328813..1328876 - 64 NuclAT_17 - -
- 1328813..1328876 - 64 NuclAT_20 - -
- 1328813..1328876 - 64 NuclAT_20 - -
- 1328813..1328876 - 64 NuclAT_20 - -
- 1328813..1328876 - 64 NuclAT_20 - -
- 1328813..1328876 - 64 NuclAT_23 - -
- 1328813..1328876 - 64 NuclAT_23 - -
- 1328813..1328876 - 64 NuclAT_23 - -
- 1328813..1328876 - 64 NuclAT_23 - -
- 1328813..1328876 - 64 NuclAT_26 - -
- 1328813..1328876 - 64 NuclAT_26 - -
- 1328813..1328876 - 64 NuclAT_26 - -
- 1328813..1328876 - 64 NuclAT_26 - -
- 1328813..1328876 - 64 NuclAT_29 - -
- 1328813..1328876 - 64 NuclAT_29 - -
- 1328813..1328876 - 64 NuclAT_29 - -
- 1328813..1328876 - 64 NuclAT_29 - -
- 1328813..1328876 - 64 NuclAT_32 - -
- 1328813..1328876 - 64 NuclAT_32 - -
- 1328813..1328876 - 64 NuclAT_32 - -
- 1328813..1328876 - 64 NuclAT_32 - -
QEN28_RS06560 1328926..1329033 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
QEN28_RS06565 1329182..1330036 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QEN28_RS06570 1330072..1330881 - 810 WP_001257044.1 invasion regulator SirB1 -
QEN28_RS06575 1330885..1331277 - 393 WP_000200392.1 invasion regulator SirB2 -
QEN28_RS06580 1331274..1332107 - 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T278390 WP_000170965.1 NZ_CP123009:1327855-1327962 [Escherichia coli O155]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT278390 NZ_CP123009:c1327808-1327742 [Escherichia coli O155]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References