Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 3910764..3911366 | Replicon | chromosome |
Accession | NZ_CP123008 | ||
Organism | Escherichia coli strain NWU_4 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | QEN27_RS18845 | Protein ID | WP_000897305.1 |
Coordinates | 3910764..3911075 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QEN27_RS18850 | Protein ID | WP_000356397.1 |
Coordinates | 3911076..3911366 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN27_RS18815 (3905794) | 3905794..3906579 | + | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
QEN27_RS18820 (3906678) | 3906678..3907277 | + | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
QEN27_RS18825 (3907271) | 3907271..3908143 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
QEN27_RS18830 (3908140) | 3908140..3908577 | + | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
QEN27_RS18835 (3908622) | 3908622..3909563 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
QEN27_RS18840 (3909627) | 3909627..3910535 | - | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
QEN27_RS18845 (3910764) | 3910764..3911075 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
QEN27_RS18850 (3911076) | 3911076..3911366 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
QEN27_RS18855 (3911971) | 3911971..3912189 | + | 219 | WP_001315930.1 | CopG family transcriptional regulator | - |
QEN27_RS18860 (3912409) | 3912409..3912651 | + | 243 | WP_001087409.1 | protein YiiF | - |
QEN27_RS18865 (3912981) | 3912981..3913910 | - | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
QEN27_RS18870 (3913907) | 3913907..3914542 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
QEN27_RS18875 (3914539) | 3914539..3915441 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T278378 WP_000897305.1 NZ_CP123008:3910764-3911075 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|