Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 1373654..1374025 | Replicon | chromosome |
| Accession | NZ_CP123008 | ||
| Organism | Escherichia coli strain NWU_4 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | F4VC37 |
| Locus tag | QEN27_RS06840 | Protein ID | WP_001317028.1 |
| Coordinates | 1373831..1374025 (-) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 1373654..1373832 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEN27_RS06810 (1369406) | 1369406..1369579 | + | 174 | WP_001296046.1 | protein YnaL | - |
| QEN27_RS06815 (1369609) | 1369609..1370982 | + | 1374 | WP_000123745.1 | ATP-dependent RNA helicase DbpA | - |
| QEN27_RS06820 (1371111) | 1371111..1372046 | - | 936 | WP_001157407.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| QEN27_RS06825 (1372098) | 1372098..1373333 | - | 1236 | WP_000040852.1 | site-specific integrase | - |
| QEN27_RS06830 (1373335) | 1373335..1373550 | - | 216 | WP_000079604.1 | excisionase XisR | - |
| - (1373654) | 1373654..1373832 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (1373654) | 1373654..1373832 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (1373654) | 1373654..1373832 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (1373654) | 1373654..1373832 | + | 179 | NuclAT_0 | - | Antitoxin |
| QEN27_RS06835 (1373650) | 1373650..1373838 | - | 189 | WP_001302840.1 | DUF1187 family protein | - |
| QEN27_RS06840 (1373831) | 1373831..1374025 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| QEN27_RS06845 (1374081) | 1374081..1374890 | - | 810 | WP_040088925.1 | recombination protein RecT | - |
| QEN27_RS06850 (1374883) | 1374883..1377504 | - | 2622 | WP_278234010.1 | exodeoxyribonuclease VIII | - |
| QEN27_RS06855 (1377606) | 1377606..1377881 | - | 276 | WP_000632297.1 | protein RacC | - |
| QEN27_RS06860 (1377956) | 1377956..1378126 | - | 171 | WP_001352098.1 | YdaE family protein | - |
| QEN27_RS06865 (1378126) | 1378126..1378347 | - | 222 | WP_000560223.1 | killing protein KilR | - |
| QEN27_RS06870 (1378769) | 1378769..1378921 | - | 153 | WP_001551042.1 | DUF1391 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1372098..1399621 | 27523 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T278361 WP_001317028.1 NZ_CP123008:c1374025-1373831 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT278361 NZ_CP123008:1373654-1373832 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTAATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTAATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
