Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1236425..1236645 Replicon chromosome
Accession NZ_CP123008
Organism Escherichia coli strain NWU_4

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag QEN27_RS06130 Protein ID WP_000170965.1
Coordinates 1236425..1236532 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1236579..1236645 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEN27_RS06100 1232280..1233113 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
QEN27_RS06105 1233110..1233502 + 393 WP_000200392.1 invasion regulator SirB2 -
QEN27_RS06110 1233506..1234315 + 810 WP_001257044.1 invasion regulator SirB1 -
QEN27_RS06115 1234351..1235205 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QEN27_RS06120 1235354..1235461 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1235509..1235575 + 67 NuclAT_52 - -
- 1235509..1235575 + 67 NuclAT_52 - -
- 1235509..1235575 + 67 NuclAT_52 - -
- 1235509..1235575 + 67 NuclAT_52 - -
- 1235511..1235574 + 64 NuclAT_17 - -
- 1235511..1235574 + 64 NuclAT_17 - -
- 1235511..1235574 + 64 NuclAT_17 - -
- 1235511..1235574 + 64 NuclAT_17 - -
- 1235511..1235574 + 64 NuclAT_20 - -
- 1235511..1235574 + 64 NuclAT_20 - -
- 1235511..1235574 + 64 NuclAT_20 - -
- 1235511..1235574 + 64 NuclAT_20 - -
- 1235511..1235574 + 64 NuclAT_23 - -
- 1235511..1235574 + 64 NuclAT_23 - -
- 1235511..1235574 + 64 NuclAT_23 - -
- 1235511..1235574 + 64 NuclAT_23 - -
- 1235511..1235574 + 64 NuclAT_26 - -
- 1235511..1235574 + 64 NuclAT_26 - -
- 1235511..1235574 + 64 NuclAT_26 - -
- 1235511..1235574 + 64 NuclAT_26 - -
- 1235511..1235574 + 64 NuclAT_29 - -
- 1235511..1235574 + 64 NuclAT_29 - -
- 1235511..1235574 + 64 NuclAT_29 - -
- 1235511..1235574 + 64 NuclAT_29 - -
- 1235511..1235574 + 64 NuclAT_32 - -
- 1235511..1235574 + 64 NuclAT_32 - -
- 1235511..1235574 + 64 NuclAT_32 - -
- 1235511..1235574 + 64 NuclAT_32 - -
- 1235511..1235576 + 66 NuclAT_35 - -
- 1235511..1235576 + 66 NuclAT_35 - -
- 1235511..1235576 + 66 NuclAT_35 - -
- 1235511..1235576 + 66 NuclAT_35 - -
- 1235511..1235576 + 66 NuclAT_38 - -
- 1235511..1235576 + 66 NuclAT_38 - -
- 1235511..1235576 + 66 NuclAT_38 - -
- 1235511..1235576 + 66 NuclAT_38 - -
- 1235511..1235576 + 66 NuclAT_41 - -
- 1235511..1235576 + 66 NuclAT_41 - -
- 1235511..1235576 + 66 NuclAT_41 - -
- 1235511..1235576 + 66 NuclAT_41 - -
- 1235511..1235576 + 66 NuclAT_44 - -
- 1235511..1235576 + 66 NuclAT_44 - -
- 1235511..1235576 + 66 NuclAT_44 - -
- 1235511..1235576 + 66 NuclAT_44 - -
- 1235511..1235576 + 66 NuclAT_47 - -
- 1235511..1235576 + 66 NuclAT_47 - -
- 1235511..1235576 + 66 NuclAT_47 - -
- 1235511..1235576 + 66 NuclAT_47 - -
- 1235511..1235576 + 66 NuclAT_50 - -
- 1235511..1235576 + 66 NuclAT_50 - -
- 1235511..1235576 + 66 NuclAT_50 - -
- 1235511..1235576 + 66 NuclAT_50 - -
QEN27_RS06125 1235889..1235996 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1236049..1236110 + 62 NuclAT_18 - -
- 1236049..1236110 + 62 NuclAT_18 - -
- 1236049..1236110 + 62 NuclAT_18 - -
- 1236049..1236110 + 62 NuclAT_18 - -
- 1236049..1236110 + 62 NuclAT_21 - -
- 1236049..1236110 + 62 NuclAT_21 - -
- 1236049..1236110 + 62 NuclAT_21 - -
- 1236049..1236110 + 62 NuclAT_21 - -
- 1236049..1236110 + 62 NuclAT_24 - -
- 1236049..1236110 + 62 NuclAT_24 - -
- 1236049..1236110 + 62 NuclAT_24 - -
- 1236049..1236110 + 62 NuclAT_24 - -
- 1236049..1236110 + 62 NuclAT_27 - -
- 1236049..1236110 + 62 NuclAT_27 - -
- 1236049..1236110 + 62 NuclAT_27 - -
- 1236049..1236110 + 62 NuclAT_27 - -
- 1236049..1236110 + 62 NuclAT_30 - -
- 1236049..1236110 + 62 NuclAT_30 - -
- 1236049..1236110 + 62 NuclAT_30 - -
- 1236049..1236110 + 62 NuclAT_30 - -
- 1236049..1236110 + 62 NuclAT_33 - -
- 1236049..1236110 + 62 NuclAT_33 - -
- 1236049..1236110 + 62 NuclAT_33 - -
- 1236049..1236110 + 62 NuclAT_33 - -
- 1236049..1236111 + 63 NuclAT_53 - -
- 1236049..1236111 + 63 NuclAT_53 - -
- 1236049..1236111 + 63 NuclAT_53 - -
- 1236049..1236111 + 63 NuclAT_53 - -
- 1236049..1236112 + 64 NuclAT_36 - -
- 1236049..1236112 + 64 NuclAT_36 - -
- 1236049..1236112 + 64 NuclAT_36 - -
- 1236049..1236112 + 64 NuclAT_36 - -
- 1236049..1236112 + 64 NuclAT_39 - -
- 1236049..1236112 + 64 NuclAT_39 - -
- 1236049..1236112 + 64 NuclAT_39 - -
- 1236049..1236112 + 64 NuclAT_39 - -
- 1236049..1236112 + 64 NuclAT_42 - -
- 1236049..1236112 + 64 NuclAT_42 - -
- 1236049..1236112 + 64 NuclAT_42 - -
- 1236049..1236112 + 64 NuclAT_42 - -
- 1236049..1236112 + 64 NuclAT_45 - -
- 1236049..1236112 + 64 NuclAT_45 - -
- 1236049..1236112 + 64 NuclAT_45 - -
- 1236049..1236112 + 64 NuclAT_45 - -
- 1236049..1236112 + 64 NuclAT_48 - -
- 1236049..1236112 + 64 NuclAT_48 - -
- 1236049..1236112 + 64 NuclAT_48 - -
- 1236049..1236112 + 64 NuclAT_48 - -
- 1236049..1236112 + 64 NuclAT_51 - -
- 1236049..1236112 + 64 NuclAT_51 - -
- 1236049..1236112 + 64 NuclAT_51 - -
- 1236049..1236112 + 64 NuclAT_51 - -
QEN27_RS06130 1236425..1236532 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1236579..1236645 + 67 - - Antitoxin
QEN27_RS06135 1236937..1238037 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
QEN27_RS06140 1238307..1238537 + 231 WP_001146442.1 putative cation transport regulator ChaB -
QEN27_RS06145 1238695..1239390 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
QEN27_RS06150 1239434..1239787 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
QEN27_RS06155 1239972..1241366 + 1395 WP_000086201.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T278360 WP_000170965.1 NZ_CP123008:c1236532-1236425 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT278360 NZ_CP123008:1236579-1236645 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References