Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1235889..1236110 | Replicon | chromosome |
| Accession | NZ_CP123008 | ||
| Organism | Escherichia coli strain NWU_4 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | E0IV43 |
| Locus tag | QEN27_RS06125 | Protein ID | WP_000170926.1 |
| Coordinates | 1235889..1235996 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1236049..1236110 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEN27_RS06095 (1231198) | 1231198..1232280 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| QEN27_RS06100 (1232280) | 1232280..1233113 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| QEN27_RS06105 (1233110) | 1233110..1233502 | + | 393 | WP_000200392.1 | invasion regulator SirB2 | - |
| QEN27_RS06110 (1233506) | 1233506..1234315 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| QEN27_RS06115 (1234351) | 1234351..1235205 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| QEN27_RS06120 (1235354) | 1235354..1235461 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1235511) | 1235511..1235574 | + | 64 | NuclAT_17 | - | - |
| - (1235511) | 1235511..1235574 | + | 64 | NuclAT_17 | - | - |
| - (1235511) | 1235511..1235574 | + | 64 | NuclAT_17 | - | - |
| - (1235511) | 1235511..1235574 | + | 64 | NuclAT_17 | - | - |
| - (1235511) | 1235511..1235574 | + | 64 | NuclAT_20 | - | - |
| - (1235511) | 1235511..1235574 | + | 64 | NuclAT_20 | - | - |
| - (1235511) | 1235511..1235574 | + | 64 | NuclAT_20 | - | - |
| - (1235511) | 1235511..1235574 | + | 64 | NuclAT_20 | - | - |
| - (1235511) | 1235511..1235574 | + | 64 | NuclAT_23 | - | - |
| - (1235511) | 1235511..1235574 | + | 64 | NuclAT_23 | - | - |
| - (1235511) | 1235511..1235574 | + | 64 | NuclAT_23 | - | - |
| - (1235511) | 1235511..1235574 | + | 64 | NuclAT_23 | - | - |
| - (1235511) | 1235511..1235574 | + | 64 | NuclAT_26 | - | - |
| - (1235511) | 1235511..1235574 | + | 64 | NuclAT_26 | - | - |
| - (1235511) | 1235511..1235574 | + | 64 | NuclAT_26 | - | - |
| - (1235511) | 1235511..1235574 | + | 64 | NuclAT_26 | - | - |
| - (1235511) | 1235511..1235574 | + | 64 | NuclAT_29 | - | - |
| - (1235511) | 1235511..1235574 | + | 64 | NuclAT_29 | - | - |
| - (1235511) | 1235511..1235574 | + | 64 | NuclAT_29 | - | - |
| - (1235511) | 1235511..1235574 | + | 64 | NuclAT_29 | - | - |
| - (1235511) | 1235511..1235574 | + | 64 | NuclAT_32 | - | - |
| - (1235511) | 1235511..1235574 | + | 64 | NuclAT_32 | - | - |
| - (1235511) | 1235511..1235574 | + | 64 | NuclAT_32 | - | - |
| - (1235511) | 1235511..1235574 | + | 64 | NuclAT_32 | - | - |
| - (1235509) | 1235509..1235575 | + | 67 | NuclAT_52 | - | - |
| - (1235509) | 1235509..1235575 | + | 67 | NuclAT_52 | - | - |
| - (1235509) | 1235509..1235575 | + | 67 | NuclAT_52 | - | - |
| - (1235509) | 1235509..1235575 | + | 67 | NuclAT_52 | - | - |
| - (1235511) | 1235511..1235576 | + | 66 | NuclAT_35 | - | - |
| - (1235511) | 1235511..1235576 | + | 66 | NuclAT_35 | - | - |
| - (1235511) | 1235511..1235576 | + | 66 | NuclAT_35 | - | - |
| - (1235511) | 1235511..1235576 | + | 66 | NuclAT_35 | - | - |
| - (1235511) | 1235511..1235576 | + | 66 | NuclAT_38 | - | - |
| - (1235511) | 1235511..1235576 | + | 66 | NuclAT_38 | - | - |
| - (1235511) | 1235511..1235576 | + | 66 | NuclAT_38 | - | - |
| - (1235511) | 1235511..1235576 | + | 66 | NuclAT_38 | - | - |
| - (1235511) | 1235511..1235576 | + | 66 | NuclAT_41 | - | - |
| - (1235511) | 1235511..1235576 | + | 66 | NuclAT_41 | - | - |
| - (1235511) | 1235511..1235576 | + | 66 | NuclAT_41 | - | - |
| - (1235511) | 1235511..1235576 | + | 66 | NuclAT_41 | - | - |
| - (1235511) | 1235511..1235576 | + | 66 | NuclAT_44 | - | - |
| - (1235511) | 1235511..1235576 | + | 66 | NuclAT_44 | - | - |
| - (1235511) | 1235511..1235576 | + | 66 | NuclAT_44 | - | - |
| - (1235511) | 1235511..1235576 | + | 66 | NuclAT_44 | - | - |
| - (1235511) | 1235511..1235576 | + | 66 | NuclAT_47 | - | - |
| - (1235511) | 1235511..1235576 | + | 66 | NuclAT_47 | - | - |
| - (1235511) | 1235511..1235576 | + | 66 | NuclAT_47 | - | - |
| - (1235511) | 1235511..1235576 | + | 66 | NuclAT_47 | - | - |
| - (1235511) | 1235511..1235576 | + | 66 | NuclAT_50 | - | - |
| - (1235511) | 1235511..1235576 | + | 66 | NuclAT_50 | - | - |
| - (1235511) | 1235511..1235576 | + | 66 | NuclAT_50 | - | - |
| - (1235511) | 1235511..1235576 | + | 66 | NuclAT_50 | - | - |
| QEN27_RS06125 (1235889) | 1235889..1235996 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (1236049) | 1236049..1236110 | + | 62 | NuclAT_18 | - | Antitoxin |
| - (1236049) | 1236049..1236110 | + | 62 | NuclAT_18 | - | Antitoxin |
| - (1236049) | 1236049..1236110 | + | 62 | NuclAT_18 | - | Antitoxin |
| - (1236049) | 1236049..1236110 | + | 62 | NuclAT_18 | - | Antitoxin |
| - (1236049) | 1236049..1236110 | + | 62 | NuclAT_21 | - | Antitoxin |
| - (1236049) | 1236049..1236110 | + | 62 | NuclAT_21 | - | Antitoxin |
| - (1236049) | 1236049..1236110 | + | 62 | NuclAT_21 | - | Antitoxin |
| - (1236049) | 1236049..1236110 | + | 62 | NuclAT_21 | - | Antitoxin |
| - (1236049) | 1236049..1236110 | + | 62 | NuclAT_24 | - | Antitoxin |
| - (1236049) | 1236049..1236110 | + | 62 | NuclAT_24 | - | Antitoxin |
| - (1236049) | 1236049..1236110 | + | 62 | NuclAT_24 | - | Antitoxin |
| - (1236049) | 1236049..1236110 | + | 62 | NuclAT_24 | - | Antitoxin |
| - (1236049) | 1236049..1236110 | + | 62 | NuclAT_27 | - | Antitoxin |
| - (1236049) | 1236049..1236110 | + | 62 | NuclAT_27 | - | Antitoxin |
| - (1236049) | 1236049..1236110 | + | 62 | NuclAT_27 | - | Antitoxin |
| - (1236049) | 1236049..1236110 | + | 62 | NuclAT_27 | - | Antitoxin |
| - (1236049) | 1236049..1236110 | + | 62 | NuclAT_30 | - | Antitoxin |
| - (1236049) | 1236049..1236110 | + | 62 | NuclAT_30 | - | Antitoxin |
| - (1236049) | 1236049..1236110 | + | 62 | NuclAT_30 | - | Antitoxin |
| - (1236049) | 1236049..1236110 | + | 62 | NuclAT_30 | - | Antitoxin |
| - (1236049) | 1236049..1236110 | + | 62 | NuclAT_33 | - | Antitoxin |
| - (1236049) | 1236049..1236110 | + | 62 | NuclAT_33 | - | Antitoxin |
| - (1236049) | 1236049..1236110 | + | 62 | NuclAT_33 | - | Antitoxin |
| - (1236049) | 1236049..1236110 | + | 62 | NuclAT_33 | - | Antitoxin |
| - (1236049) | 1236049..1236111 | + | 63 | NuclAT_53 | - | - |
| - (1236049) | 1236049..1236111 | + | 63 | NuclAT_53 | - | - |
| - (1236049) | 1236049..1236111 | + | 63 | NuclAT_53 | - | - |
| - (1236049) | 1236049..1236111 | + | 63 | NuclAT_53 | - | - |
| - (1236049) | 1236049..1236112 | + | 64 | NuclAT_36 | - | - |
| - (1236049) | 1236049..1236112 | + | 64 | NuclAT_36 | - | - |
| - (1236049) | 1236049..1236112 | + | 64 | NuclAT_36 | - | - |
| - (1236049) | 1236049..1236112 | + | 64 | NuclAT_36 | - | - |
| - (1236049) | 1236049..1236112 | + | 64 | NuclAT_39 | - | - |
| - (1236049) | 1236049..1236112 | + | 64 | NuclAT_39 | - | - |
| - (1236049) | 1236049..1236112 | + | 64 | NuclAT_39 | - | - |
| - (1236049) | 1236049..1236112 | + | 64 | NuclAT_39 | - | - |
| - (1236049) | 1236049..1236112 | + | 64 | NuclAT_42 | - | - |
| - (1236049) | 1236049..1236112 | + | 64 | NuclAT_42 | - | - |
| - (1236049) | 1236049..1236112 | + | 64 | NuclAT_42 | - | - |
| - (1236049) | 1236049..1236112 | + | 64 | NuclAT_42 | - | - |
| - (1236049) | 1236049..1236112 | + | 64 | NuclAT_45 | - | - |
| - (1236049) | 1236049..1236112 | + | 64 | NuclAT_45 | - | - |
| - (1236049) | 1236049..1236112 | + | 64 | NuclAT_45 | - | - |
| - (1236049) | 1236049..1236112 | + | 64 | NuclAT_45 | - | - |
| - (1236049) | 1236049..1236112 | + | 64 | NuclAT_48 | - | - |
| - (1236049) | 1236049..1236112 | + | 64 | NuclAT_48 | - | - |
| - (1236049) | 1236049..1236112 | + | 64 | NuclAT_48 | - | - |
| - (1236049) | 1236049..1236112 | + | 64 | NuclAT_48 | - | - |
| - (1236049) | 1236049..1236112 | + | 64 | NuclAT_51 | - | - |
| - (1236049) | 1236049..1236112 | + | 64 | NuclAT_51 | - | - |
| - (1236049) | 1236049..1236112 | + | 64 | NuclAT_51 | - | - |
| - (1236049) | 1236049..1236112 | + | 64 | NuclAT_51 | - | - |
| QEN27_RS06130 (1236425) | 1236425..1236532 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1236580) | 1236580..1236645 | + | 66 | NuclAT_16 | - | - |
| - (1236580) | 1236580..1236645 | + | 66 | NuclAT_16 | - | - |
| - (1236580) | 1236580..1236645 | + | 66 | NuclAT_16 | - | - |
| - (1236580) | 1236580..1236645 | + | 66 | NuclAT_16 | - | - |
| - (1236580) | 1236580..1236645 | + | 66 | NuclAT_19 | - | - |
| - (1236580) | 1236580..1236645 | + | 66 | NuclAT_19 | - | - |
| - (1236580) | 1236580..1236645 | + | 66 | NuclAT_19 | - | - |
| - (1236580) | 1236580..1236645 | + | 66 | NuclAT_19 | - | - |
| - (1236580) | 1236580..1236645 | + | 66 | NuclAT_22 | - | - |
| - (1236580) | 1236580..1236645 | + | 66 | NuclAT_22 | - | - |
| - (1236580) | 1236580..1236645 | + | 66 | NuclAT_22 | - | - |
| - (1236580) | 1236580..1236645 | + | 66 | NuclAT_22 | - | - |
| - (1236580) | 1236580..1236645 | + | 66 | NuclAT_25 | - | - |
| - (1236580) | 1236580..1236645 | + | 66 | NuclAT_25 | - | - |
| - (1236580) | 1236580..1236645 | + | 66 | NuclAT_25 | - | - |
| - (1236580) | 1236580..1236645 | + | 66 | NuclAT_25 | - | - |
| - (1236580) | 1236580..1236645 | + | 66 | NuclAT_28 | - | - |
| - (1236580) | 1236580..1236645 | + | 66 | NuclAT_28 | - | - |
| - (1236580) | 1236580..1236645 | + | 66 | NuclAT_28 | - | - |
| - (1236580) | 1236580..1236645 | + | 66 | NuclAT_28 | - | - |
| - (1236580) | 1236580..1236645 | + | 66 | NuclAT_31 | - | - |
| - (1236580) | 1236580..1236645 | + | 66 | NuclAT_31 | - | - |
| - (1236580) | 1236580..1236645 | + | 66 | NuclAT_31 | - | - |
| - (1236580) | 1236580..1236645 | + | 66 | NuclAT_31 | - | - |
| - (1236581) | 1236581..1236646 | + | 66 | NuclAT_54 | - | - |
| - (1236581) | 1236581..1236646 | + | 66 | NuclAT_54 | - | - |
| - (1236581) | 1236581..1236646 | + | 66 | NuclAT_54 | - | - |
| - (1236581) | 1236581..1236646 | + | 66 | NuclAT_54 | - | - |
| - (1236580) | 1236580..1236647 | + | 68 | NuclAT_34 | - | - |
| - (1236580) | 1236580..1236647 | + | 68 | NuclAT_34 | - | - |
| - (1236580) | 1236580..1236647 | + | 68 | NuclAT_34 | - | - |
| - (1236580) | 1236580..1236647 | + | 68 | NuclAT_34 | - | - |
| - (1236580) | 1236580..1236647 | + | 68 | NuclAT_37 | - | - |
| - (1236580) | 1236580..1236647 | + | 68 | NuclAT_37 | - | - |
| - (1236580) | 1236580..1236647 | + | 68 | NuclAT_37 | - | - |
| - (1236580) | 1236580..1236647 | + | 68 | NuclAT_37 | - | - |
| - (1236580) | 1236580..1236647 | + | 68 | NuclAT_40 | - | - |
| - (1236580) | 1236580..1236647 | + | 68 | NuclAT_40 | - | - |
| - (1236580) | 1236580..1236647 | + | 68 | NuclAT_40 | - | - |
| - (1236580) | 1236580..1236647 | + | 68 | NuclAT_40 | - | - |
| - (1236580) | 1236580..1236647 | + | 68 | NuclAT_43 | - | - |
| - (1236580) | 1236580..1236647 | + | 68 | NuclAT_43 | - | - |
| - (1236580) | 1236580..1236647 | + | 68 | NuclAT_43 | - | - |
| - (1236580) | 1236580..1236647 | + | 68 | NuclAT_43 | - | - |
| - (1236580) | 1236580..1236647 | + | 68 | NuclAT_46 | - | - |
| - (1236580) | 1236580..1236647 | + | 68 | NuclAT_46 | - | - |
| - (1236580) | 1236580..1236647 | + | 68 | NuclAT_46 | - | - |
| - (1236580) | 1236580..1236647 | + | 68 | NuclAT_46 | - | - |
| - (1236580) | 1236580..1236647 | + | 68 | NuclAT_49 | - | - |
| - (1236580) | 1236580..1236647 | + | 68 | NuclAT_49 | - | - |
| - (1236580) | 1236580..1236647 | + | 68 | NuclAT_49 | - | - |
| - (1236580) | 1236580..1236647 | + | 68 | NuclAT_49 | - | - |
| QEN27_RS06135 (1236937) | 1236937..1238037 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| QEN27_RS06140 (1238307) | 1238307..1238537 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| QEN27_RS06145 (1238695) | 1238695..1239390 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| QEN27_RS06150 (1239434) | 1239434..1239787 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.84 Da Isoelectric Point: 11.6501
>T278356 WP_000170926.1 NZ_CP123008:c1235996-1235889 [Escherichia coli]
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 62 bp
>AT278356 NZ_CP123008:1236049-1236110 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|