Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1187955..1188573 | Replicon | chromosome |
Accession | NZ_CP123003 | ||
Organism | Sinorhizobium meliloti strain BIM B-442D |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q92R61 |
Locus tag | QC756_RS05815 | Protein ID | WP_010969011.1 |
Coordinates | 1188277..1188573 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QC756_RS05810 | Protein ID | WP_010969010.1 |
Coordinates | 1187955..1188263 (-) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QC756_RS05765 (QC756_05765) | 1183610..1183852 | + | 243 | WP_280097526.1 | hypothetical protein | - |
QC756_RS05770 (QC756_05770) | 1183907..1184272 | + | 366 | WP_280097527.1 | hypothetical protein | - |
QC756_RS05775 (QC756_05775) | 1184726..1184926 | + | 201 | WP_127524705.1 | hypothetical protein | - |
QC756_RS05780 (QC756_05780) | 1185121..1185270 | + | 150 | WP_014529577.1 | hypothetical protein | - |
QC756_RS05785 (QC756_05785) | 1185493..1186629 | - | 1137 | Protein_1137 | TlpA disulfide reductase family protein | - |
QC756_RS05790 (QC756_05790) | 1186791..1186872 | - | 82 | Protein_1138 | nitrogen fixation protein FixA | - |
QC756_RS05795 (QC756_05795) | 1186876..1187375 | + | 500 | Protein_1139 | ATP-dependent DNA ligase | - |
QC756_RS05805 (QC756_05805) | 1187714..1187944 | - | 231 | WP_026029805.1 | hypothetical protein | - |
QC756_RS05810 (QC756_05810) | 1187955..1188263 | - | 309 | WP_010969010.1 | HigA family addiction module antitoxin | Antitoxin |
QC756_RS05815 (QC756_05815) | 1188277..1188573 | - | 297 | WP_010969011.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QC756_RS05820 (QC756_05820) | 1188621..1188926 | - | 306 | WP_003527305.1 | hypothetical protein | - |
QC756_RS05825 (QC756_05825) | 1189254..1190291 | + | 1038 | WP_003527304.1 | porin | - |
QC756_RS05830 (QC756_05830) | 1190401..1191468 | - | 1068 | WP_014526650.1 | site-specific integrase | - |
QC756_RS05835 (QC756_05835) | 1191509..1192558 | - | 1050 | WP_010969013.1 | porin | - |
QC756_RS05840 (QC756_05840) | 1192772..1193260 | - | 489 | WP_013844230.1 | BA14K family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11677.11 Da Isoelectric Point: 6.7260
>T278333 WP_010969011.1 NZ_CP123003:c1188573-1188277 [Sinorhizobium meliloti]
VIVGFRDDWLRTFFVDDVRSRNIPYDLEARLFRKLQMIDDAATDQDLRVPPSNHFEKLRGNLAGLHSIRVNQQWRLIFRW
DGTRGEADGIYLDDHSYR
VIVGFRDDWLRTFFVDDVRSRNIPYDLEARLFRKLQMIDDAATDQDLRVPPSNHFEKLRGNLAGLHSIRVNQQWRLIFRW
DGTRGEADGIYLDDHSYR
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|