Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2540778..2541389 | Replicon | chromosome |
Accession | NZ_CP123000 | ||
Organism | Neorhizobium petrolearium strain OS53 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | QEO92_RS12785 | Protein ID | WP_227703283.1 |
Coordinates | 2541108..2541389 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QEO92_RS12780 | Protein ID | WP_037148097.1 |
Coordinates | 2540778..2541080 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEO92_RS12750 (QEO92_12750) | 2536599..2537186 | - | 588 | WP_227703278.1 | ATP-dependent Clp protease proteolytic subunit | - |
QEO92_RS12755 (QEO92_12755) | 2537406..2537993 | + | 588 | WP_227703279.1 | HupE/UreJ family protein | - |
QEO92_RS12760 (QEO92_12760) | 2538090..2538905 | + | 816 | WP_227703280.1 | DUF2076 domain-containing protein | - |
QEO92_RS12765 (QEO92_12765) | 2538996..2539193 | - | 198 | WP_227703281.1 | hypothetical protein | - |
QEO92_RS12770 (QEO92_12770) | 2539215..2539679 | - | 465 | WP_210054088.1 | preQ(1) synthase | - |
QEO92_RS12775 (QEO92_12775) | 2539676..2540596 | - | 921 | WP_227703282.1 | cation diffusion facilitator family transporter | - |
QEO92_RS12780 (QEO92_12780) | 2540778..2541080 | - | 303 | WP_037148097.1 | HigA family addiction module antitoxin | Antitoxin |
QEO92_RS12785 (QEO92_12785) | 2541108..2541389 | - | 282 | WP_227703283.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QEO92_RS12790 (QEO92_12790) | 2541471..2542079 | - | 609 | WP_227703284.1 | LysE family translocator | - |
QEO92_RS12795 (QEO92_12795) | 2542136..2542639 | - | 504 | WP_227703285.1 | GNAT family protein | - |
QEO92_RS12800 (QEO92_12800) | 2542642..2544831 | - | 2190 | WP_037148103.1 | anthranilate synthase | - |
QEO92_RS12805 (QEO92_12805) | 2545109..2546008 | + | 900 | WP_227703286.1 | extensin family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10590.93 Da Isoelectric Point: 8.0477
>T278320 WP_227703283.1 NZ_CP123000:c2541389-2541108 [Neorhizobium petrolearium]
VIRSFRDKLTQSIDDGTVRKGFPSDLVRRAQQLLTVLNAATSLEDLRSPPGNRLEKLSGDREGQHSIRINKQWRICFVWT
EAGPGEVEITDYH
VIRSFRDKLTQSIDDGTVRKGFPSDLVRRAQQLLTVLNAATSLEDLRSPPGNRLEKLSGDREGQHSIRINKQWRICFVWT
EAGPGEVEITDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|