Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ(toxin) |
Location | 1404223..1404811 | Replicon | chromosome |
Accession | NZ_CP122956 | ||
Organism | Helicobacter pylori strain BT112 |
Toxin (Protein)
Gene name | TfiT | Uniprot ID | - |
Locus tag | QAD58_RS06795 | Protein ID | WP_286448266.1 |
Coordinates | 1404530..1404811 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | TfiA | Uniprot ID | T5CU17 |
Locus tag | QAD58_RS06790 | Protein ID | WP_000065285.1 |
Coordinates | 1404223..1404537 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QAD58_RS06770 (QAD58_06775) | 1399757..1400413 | + | 657 | WP_286448265.1 | ParA family protein | - |
QAD58_RS06775 (QAD58_06780) | 1400495..1400779 | + | 285 | WP_000394639.1 | hypothetical protein | - |
QAD58_RS06780 (QAD58_06785) | 1400861..1401994 | + | 1134 | WP_286449048.1 | hypothetical protein | - |
QAD58_RS06785 (QAD58_06790) | 1402019..1403928 | - | 1910 | Protein_1318 | relaxase/mobilization nuclease domain-containing protein | - |
QAD58_RS06790 (QAD58_06795) | 1404223..1404537 | + | 315 | WP_000065285.1 | hypothetical protein | Antitoxin |
QAD58_RS06795 (QAD58_06800) | 1404530..1404811 | + | 282 | WP_286448266.1 | YafQ family addiction module toxin | Toxin |
QAD58_RS06800 (QAD58_06805) | 1405086..1405556 | - | 471 | WP_180527932.1 | TraM recognition domain-containing protein | - |
QAD58_RS06805 (QAD58_06810) | 1405584..1405844 | - | 261 | WP_000602756.1 | hypothetical protein | - |
QAD58_RS06810 (QAD58_06815) | 1405845..1406063 | - | 219 | WP_286448267.1 | TrbC/VirB2 family protein | - |
QAD58_RS06815 (QAD58_06820) | 1406137..1408053 | - | 1917 | WP_286448268.1 | hypothetical protein | - |
QAD58_RS06820 (QAD58_06825) | 1408064..1408838 | - | 775 | Protein_1325 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10972.86 Da Isoelectric Point: 10.0752
>T278300 WP_286448266.1 NZ_CP122956:1404530-1404811 [Helicobacter pylori]
MLKVRTKKDFLKDFNKHILSGRITESDVTSVVDRLKEQRPLQQKYCDHALSGNLKGLRECHVKPNLLLIYEIKKQENELV
LLRLDTHSELFKK
MLKVRTKKDFLKDFNKHILSGRITESDVTSVVDRLKEQRPLQQKYCDHALSGNLKGLRECHVKPNLLLIYEIKKQENELV
LLRLDTHSELFKK
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|