Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) DinJ-YafQ (relBE)/YafQ(toxin)
Location 652073..652661 Replicon chromosome
Accession NZ_CP122955
Organism Helicobacter pylori strain BS27-2

Toxin (Protein)


Gene name TfiT Uniprot ID A0A0B2EXV0
Locus tag QAP03_RS03130 Protein ID WP_039091279.1
Coordinates 652380..652661 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name TfiA Uniprot ID I9TJZ8
Locus tag QAP03_RS03125 Protein ID WP_000073112.1
Coordinates 652073..652387 (+) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QAP03_RS03105 (QAP03_03100) 647488..648146 + 659 Protein_606 ParA family protein -
QAP03_RS03110 (QAP03_03105) 648228..648512 + 285 WP_000394650.1 hypothetical protein -
QAP03_RS03115 (QAP03_03110) 648544..649722 + 1179 WP_286490756.1 hypothetical protein -
QAP03_RS03120 (QAP03_03115) 649747..651660 - 1914 WP_286490754.1 relaxase/mobilization nuclease domain-containing protein -
QAP03_RS03125 (QAP03_03120) 652073..652387 + 315 WP_000073112.1 hypothetical protein Antitoxin
QAP03_RS03130 (QAP03_03125) 652380..652661 + 282 WP_039091279.1 YafQ family addiction module toxin Toxin
QAP03_RS03135 (QAP03_03130) 652912..654654 - 1743 WP_286490752.1 type IV secretory system conjugative DNA transfer family protein -
QAP03_RS03140 (QAP03_03135) 654655..655213 - 559 Protein_613 hypothetical protein -
QAP03_RS03145 (QAP03_03140) 655214..655504 - 291 WP_096468234.1 hypothetical protein -
QAP03_RS03150 (QAP03_03145) 655501..655941 - 441 WP_286494543.1 mobilization protein -
QAP03_RS03155 (QAP03_03150) 657343..657636 - 294 WP_286490750.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - cds6 / cag1 / cag3 / virB1 / virD4 / virB11 / cagZ / virB9/cagX / virB6/cagW / virB8/cagV / cagU / virB7/cagT / cagS / cagQ / cagM / cagN / virB5/cagL / cagI / cagH / cagG / cagF / virB4/cagE / cagD / virB2/cagC / cagA / fliN / cheV3 / flaA / hopH / futB / wbpB / fliP 602428..898206 295778


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-92)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10931.91 Da        Isoelectric Point: 10.0264

>T278296 WP_039091279.1 NZ_CP122955:652380-652661 [Helicobacter pylori]
MLKVRTKKDFLKDFNKHILSGRITENDVTSIVDCLKKQKPLQQKYCDHALSGNLKGLRECHVKPNLLLIYEIKKQENELV
LLRLDTHSELFKK

Download         Length: 282 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 12092.53 Da        Isoelectric Point: 5.2066

>AT278296 WP_000073112.1 NZ_CP122955:652073-652387 [Helicobacter pylori]
MSNVITDYSQYNEKQLHNFLNSIEKQLLKAEGDKNKAIKKIQECELQEQMIRQVLAQKHSQEKEPTPSLLNTIASKDDPE
CDVSFGDFNDFLQIAKQERERHNA

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0B2EXV0

Antitoxin

Source ID Structure
AlphaFold DB I9TJZ8

References