Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ(toxin) |
Location | 1000026..1000614 | Replicon | chromosome |
Accession | NZ_CP122952 | ||
Organism | Helicobacter pylori strain BS27-1 |
Toxin (Protein)
Gene name | TfiT | Uniprot ID | A0A0B2EXV0 |
Locus tag | QAP05_RS04795 | Protein ID | WP_039091279.1 |
Coordinates | 1000026..1000307 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | TfiA | Uniprot ID | I9TJZ8 |
Locus tag | QAP05_RS04800 | Protein ID | WP_000073112.1 |
Coordinates | 1000300..1000614 (-) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QAP05_RS04770 (QAP05_04770) | 995051..995344 | + | 294 | WP_286490750.1 | hypothetical protein | - |
QAP05_RS04775 (QAP05_04775) | 996746..997186 | + | 441 | WP_286494543.1 | mobilization protein | - |
QAP05_RS04780 (QAP05_04780) | 997183..997473 | + | 291 | WP_096468234.1 | hypothetical protein | - |
QAP05_RS04785 (QAP05_04785) | 997474..998032 | + | 559 | Protein_925 | hypothetical protein | - |
QAP05_RS04790 (QAP05_04790) | 998033..999775 | + | 1743 | WP_286490752.1 | type IV secretory system conjugative DNA transfer family protein | - |
QAP05_RS04795 (QAP05_04795) | 1000026..1000307 | - | 282 | WP_039091279.1 | YafQ family addiction module toxin | Toxin |
QAP05_RS04800 (QAP05_04800) | 1000300..1000614 | - | 315 | WP_000073112.1 | hypothetical protein | Antitoxin |
QAP05_RS04805 (QAP05_04805) | 1001027..1002940 | + | 1914 | WP_286490754.1 | relaxase/mobilization nuclease domain-containing protein | - |
QAP05_RS04810 (QAP05_04810) | 1002965..1004143 | - | 1179 | WP_286490756.1 | hypothetical protein | - |
QAP05_RS04815 (QAP05_04815) | 1004175..1004459 | - | 285 | WP_000394650.1 | hypothetical protein | - |
QAP05_RS04820 (QAP05_04820) | 1004541..1005199 | - | 659 | Protein_932 | ParA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10931.91 Da Isoelectric Point: 10.0264
>T278295 WP_039091279.1 NZ_CP122952:c1000307-1000026 [Helicobacter pylori]
MLKVRTKKDFLKDFNKHILSGRITENDVTSIVDCLKKQKPLQQKYCDHALSGNLKGLRECHVKPNLLLIYEIKKQENELV
LLRLDTHSELFKK
MLKVRTKKDFLKDFNKHILSGRITENDVTSIVDCLKKQKPLQQKYCDHALSGNLKGLRECHVKPNLLLIYEIKKQENELV
LLRLDTHSELFKK
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B2EXV0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | I9TJZ8 |