Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4878587..4879189 | Replicon | chromosome |
Accession | NZ_CP122938 | ||
Organism | Escherichia coli strain ETEC1701 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | QDX07_RS24015 | Protein ID | WP_000897305.1 |
Coordinates | 4878878..4879189 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QDX07_RS24010 | Protein ID | WP_000356395.1 |
Coordinates | 4878587..4878877 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX07_RS23975 (4874211) | 4874211..4875113 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
QDX07_RS23980 (4875110) | 4875110..4875745 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
QDX07_RS23985 (4875742) | 4875742..4876671 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
QDX07_RS23990 (4876853) | 4876853..4877095 | - | 243 | WP_001306649.1 | protein YiiF | - |
QDX07_RS23995 (4877314) | 4877314..4877532 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
QDX07_RS24000 (4877951) | 4877951..4878229 | - | 279 | WP_001306650.1 | hypothetical protein | - |
QDX07_RS24005 (4878281) | 4878281..4878502 | - | 222 | WP_001550354.1 | hypothetical protein | - |
QDX07_RS24010 (4878587) | 4878587..4878877 | - | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
QDX07_RS24015 (4878878) | 4878878..4879189 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
QDX07_RS24020 (4879418) | 4879418..4880326 | + | 909 | WP_001306651.1 | alpha/beta hydrolase | - |
QDX07_RS24025 (4880495) | 4880495..4881409 | - | 915 | WP_225102955.1 | transposase | - |
QDX07_RS24030 (4881422) | 4881422..4882309 | - | 888 | Protein_4698 | hypothetical protein | - |
QDX07_RS24035 (4882725) | 4882725..4883666 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
QDX07_RS24040 (4883711) | 4883711..4884148 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T278281 WP_000897305.1 NZ_CP122938:c4879189-4878878 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|