Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 4010648..4011342 Replicon chromosome
Accession NZ_CP122938
Organism Escherichia coli strain ETEC1701

Toxin (Protein)


Gene name yafO Uniprot ID A0A0D8WHS4
Locus tag QDX07_RS19800 Protein ID WP_001521903.1
Coordinates 4010648..4011046 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag QDX07_RS19805 Protein ID WP_000554755.1
Coordinates 4011049..4011342 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX07_RS19770 (4005783) 4005783..4007240 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
QDX07_RS19775 (4007249) 4007249..4007530 + 282 WP_077881290.1 hypothetical protein -
QDX07_RS19780 (4007547) 4007547..4008056 - 510 WP_063085380.1 metal-dependent hydrolase -
QDX07_RS19785 (4008118) 4008118..4008732 - 615 WP_000602129.1 peptide chain release factor H -
QDX07_RS19790 (4008729) 4008729..4009868 - 1140 WP_063085369.1 RNA ligase RtcB family protein -
QDX07_RS19795 (4010186) 4010186..4010638 - 453 WP_001059858.1 GNAT family N-acetyltransferase -
QDX07_RS19800 (4010648) 4010648..4011046 - 399 WP_001521903.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
QDX07_RS19805 (4011049) 4011049..4011342 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
QDX07_RS19810 (4011394) 4011394..4012449 - 1056 WP_001226166.1 DNA polymerase IV -
QDX07_RS19815 (4012520) 4012520..4013305 - 786 WP_074150236.1 putative lateral flagellar export/assembly protein LafU -
QDX07_RS19820 (4013277) 4013277..4014989 + 1713 Protein_3883 flagellar biosynthesis protein FlhA -
QDX07_RS19825 (4015094) 4015094..4015372 + 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
QDX07_RS19830 (4015365) 4015365..4015721 + 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15471.88 Da        Isoelectric Point: 8.0949

>T278277 WP_001521903.1 NZ_CP122938:c4011046-4010648 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT278277 WP_000554755.1 NZ_CP122938:c4011342-4011049 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D8WHS4

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References