Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 4010648..4011342 | Replicon | chromosome |
| Accession | NZ_CP122938 | ||
| Organism | Escherichia coli strain ETEC1701 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | A0A0D8WHS4 |
| Locus tag | QDX07_RS19800 | Protein ID | WP_001521903.1 |
| Coordinates | 4010648..4011046 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | L4JHF0 |
| Locus tag | QDX07_RS19805 | Protein ID | WP_000554755.1 |
| Coordinates | 4011049..4011342 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX07_RS19770 (4005783) | 4005783..4007240 | + | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
| QDX07_RS19775 (4007249) | 4007249..4007530 | + | 282 | WP_077881290.1 | hypothetical protein | - |
| QDX07_RS19780 (4007547) | 4007547..4008056 | - | 510 | WP_063085380.1 | metal-dependent hydrolase | - |
| QDX07_RS19785 (4008118) | 4008118..4008732 | - | 615 | WP_000602129.1 | peptide chain release factor H | - |
| QDX07_RS19790 (4008729) | 4008729..4009868 | - | 1140 | WP_063085369.1 | RNA ligase RtcB family protein | - |
| QDX07_RS19795 (4010186) | 4010186..4010638 | - | 453 | WP_001059858.1 | GNAT family N-acetyltransferase | - |
| QDX07_RS19800 (4010648) | 4010648..4011046 | - | 399 | WP_001521903.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| QDX07_RS19805 (4011049) | 4011049..4011342 | - | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| QDX07_RS19810 (4011394) | 4011394..4012449 | - | 1056 | WP_001226166.1 | DNA polymerase IV | - |
| QDX07_RS19815 (4012520) | 4012520..4013305 | - | 786 | WP_074150236.1 | putative lateral flagellar export/assembly protein LafU | - |
| QDX07_RS19820 (4013277) | 4013277..4014989 | + | 1713 | Protein_3883 | flagellar biosynthesis protein FlhA | - |
| QDX07_RS19825 (4015094) | 4015094..4015372 | + | 279 | WP_000598760.1 | type II toxin-antitoxin system HicA family toxin | - |
| QDX07_RS19830 (4015365) | 4015365..4015721 | + | 357 | WP_001030484.1 | type II toxin-antitoxin system HicB family antitoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15471.88 Da Isoelectric Point: 8.0949
>T278277 WP_001521903.1 NZ_CP122938:c4011046-4010648 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0D8WHS4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829G9H5 |