Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 2667984..2668355 | Replicon | chromosome |
| Accession | NZ_CP122938 | ||
| Organism | Escherichia coli strain ETEC1701 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | A0A839BBC2 |
| Locus tag | QDX07_RS13080 | Protein ID | WP_021500490.1 |
| Coordinates | 2667984..2668178 (+) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 2668177..2668355 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX07_RS13060 (2663114) | 2663114..2663284 | + | 171 | WP_065336296.1 | YdaE family protein | - |
| QDX07_RS13065 (2663359) | 2663359..2663634 | + | 276 | WP_001372690.1 | hypothetical protein | - |
| QDX07_RS13070 (2663734) | 2663734..2666856 | + | 3123 | WP_000105090.1 | exodeoxyribonuclease VIII | - |
| QDX07_RS13075 (2666868) | 2666868..2667920 | + | 1053 | WP_001004412.1 | RecT family recombinase | - |
| QDX07_RS13080 (2667984) | 2667984..2668178 | + | 195 | WP_021500490.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| - (2668177) | 2668177..2668355 | - | 179 | NuclAT_1 | - | Antitoxin |
| - (2668177) | 2668177..2668355 | - | 179 | NuclAT_1 | - | Antitoxin |
| - (2668177) | 2668177..2668355 | - | 179 | NuclAT_1 | - | Antitoxin |
| - (2668177) | 2668177..2668355 | - | 179 | NuclAT_1 | - | Antitoxin |
| QDX07_RS13085 (2668171) | 2668171..2668359 | + | 189 | WP_001372676.1 | DUF1187 family protein | - |
| QDX07_RS13090 (2668459) | 2668459..2668674 | + | 216 | WP_000079604.1 | excisionase XisR | - |
| QDX07_RS13095 (2668676) | 2668676..2669911 | + | 1236 | WP_024168543.1 | site-specific integrase | - |
| QDX07_RS13100 (2669963) | 2669963..2670898 | + | 936 | WP_001157382.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| QDX07_RS13105 (2671027) | 2671027..2672400 | - | 1374 | WP_063085924.1 | ATP-dependent RNA helicase DbpA | - |
| QDX07_RS13110 (2672430) | 2672430..2672603 | - | 174 | WP_001296046.1 | protein YnaL | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2619392..2669911 | 50519 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7046.98 Da Isoelectric Point: 9.2886
>T278270 WP_021500490.1 NZ_CP122938:2667984-2668178 [Escherichia coli]
MRYEKVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYEKVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT278270 NZ_CP122938:c2668355-2668177 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTCCCTGA
GAGCATTTTTTCGCATTCCGATTTGGTTAACTTTGTTTTTGAGTACCTTGTCCAGCTGGTAGGAGAACCACCTTCCTTTT
CAATAGTGGCGGTGATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTCCCTGA
GAGCATTTTTTCGCATTCCGATTTGGTTAACTTTGTTTTTGAGTACCTTGTCCAGCTGGTAGGAGAACCACCTTCCTTTT
CAATAGTGGCGGTGATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|