Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 2066..2712 | Replicon | plasmid unnamed5 |
Accession | NZ_CP122934 | ||
Organism | Escherichia coli strain ETEC1702 |
Toxin (Protein)
Gene name | higB | Uniprot ID | F4T8Q4 |
Locus tag | QDX05_RS25045 | Protein ID | WP_000269926.1 |
Coordinates | 2066..2416 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | F4T8Q5 |
Locus tag | QDX05_RS25050 | Protein ID | WP_001259443.1 |
Coordinates | 2413..2712 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX05_RS25025 (QDX05_25020) | 1..306 | + | 306 | Protein_0 | hypothetical protein | - |
QDX05_RS25030 (QDX05_25025) | 485..748 | + | 264 | WP_001312455.1 | PilI type IV pilus biogenesis protein | - |
QDX05_RS25035 (QDX05_25030) | 780..1013 | - | 234 | WP_000024515.1 | hypothetical protein | - |
QDX05_RS25040 (QDX05_25035) | 1053..1700 | - | 648 | WP_000214917.1 | ParA family protein | - |
QDX05_RS25045 (QDX05_25040) | 2066..2416 | + | 351 | WP_000269926.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QDX05_RS25050 (QDX05_25045) | 2413..2712 | + | 300 | WP_001259443.1 | XRE family transcriptional regulator | Antitoxin |
QDX05_RS25055 (QDX05_25050) | 2743..2988 | - | 246 | WP_001193619.1 | hypothetical protein | - |
QDX05_RS25060 (QDX05_25055) | 2978..3235 | - | 258 | WP_000845367.1 | hypothetical protein | - |
QDX05_RS25065 (QDX05_25060) | 3271..3813 | - | 543 | WP_000206647.1 | hypothetical protein | - |
QDX05_RS25070 (QDX05_25065) | 3941..4474 | - | 534 | WP_001025389.1 | J domain-containing protein | - |
QDX05_RS25075 (QDX05_25070) | 4845..5144 | - | 300 | WP_000113288.1 | hypothetical protein | - |
QDX05_RS25080 (QDX05_25075) | 5218..5490 | - | 273 | WP_001272119.1 | hypothetical protein | - |
QDX05_RS25085 (QDX05_25080) | 6441..7106 | - | 666 | WP_001350943.1 | RepA family replication protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | - | 1..24405 | 24405 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13742.77 Da Isoelectric Point: 7.4217
>T278256 WP_000269926.1 NZ_CP122934:2066-2416 [Escherichia coli]
MWTVYFGRLFDEWFEEQELALKRKVLAELKHLEEFGPSLSRPHADTVKGSRHKNMKELRIQYEGHPIRAFFAFDPIRQAI
ILCAGDKSNDKKFYDRMIRIADEEFSTHLAELEGKK
MWTVYFGRLFDEWFEEQELALKRKVLAELKHLEEFGPSLSRPHADTVKGSRHKNMKELRIQYEGHPIRAFFAFDPIRQAI
ILCAGDKSNDKKFYDRMIRIADEEFSTHLAELEGKK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A743U745 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A743U677 |