Detailed information of TA system TA278252

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 105878..106304
• Replicon: plasmid unnamed2
• Accession: NZ_CP122931
• Organism: Escherichia coli strain ETEC1702

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QDX05_RS24025
• Protein ID: WP_001372321.1
• Coordinates: 105878..106003 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	106080..106304 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QDX05_RS23985 (100918)	100918..101145	-	228	WP_001254388.1	conjugal transfer relaxosome protein TraY	-
QDX05_RS23990 (101239)	101239..101925	-	687	WP_000332487.1	PAS domain-containing protein	-
QDX05_RS23995 (102119)	102119..102502	-	384	WP_001151564.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QDX05_RS24000 (102797)	102797..103435	+	639	WP_281440555.1	transglycosylase SLT domain-containing protein	-
QDX05_RS24005 (103732)	103732..104553	-	822	WP_001234469.1	DUF932 domain-containing protein	-
QDX05_RS24010 (104672)	104672..104959	-	288	WP_000107537.1	hypothetical protein	-
QDX05_RS24015 (105257)	105257..105430	+	174	Protein_128	hypothetical protein	-
QDX05_RS24020 (105428)	105428..105658	-	231	WP_071587244.1	hypothetical protein	-
QDX05_RS24025 (105878)	105878..106003	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QDX05_RS24030 (105945)	105945..106094	-	150	Protein_131	plasmid maintenance protein Mok	-
- (106080)	106080..106304	-	225	NuclAT_0	-	Antitoxin
- (106080)	106080..106304	-	225	NuclAT_0	-	Antitoxin
- (106080)	106080..106304	-	225	NuclAT_0	-	Antitoxin
- (106080)	106080..106304	-	225	NuclAT_0	-	Antitoxin
QDX05_RS24035 (106116)	106116..106304	+	189	WP_001299721.1	hypothetical protein	-
QDX05_RS24040 (106273)	106273..107035	-	763	Protein_133	plasmid SOS inhibition protein A	-
QDX05_RS24045 (107032)	107032..107466	-	435	WP_000845901.1	conjugation system SOS inhibitor PsiB	-
QDX05_RS24050 (107521)	107521..109479	-	1959	WP_001145469.1	ParB/RepB/Spo0J family partition protein	-
QDX05_RS24055 (109538)	109538..109771	-	234	WP_000006004.1	DUF905 domain-containing protein	-
QDX05_RS24060 (110134)	110134..110880	+	747	WP_230079686.1	abortive infection system antitoxin AbiGi family protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T278252 WP_001372321.1 NZ_CP122931:c106003-105878 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT278252 NZ_CP122931:c106304-106080 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin