Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3707634..3708328 | Replicon | chromosome |
| Accession | NZ_CP122929 | ||
| Organism | Escherichia coli strain ETEC1702 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q47157 |
| Locus tag | QDX05_RS18425 | Protein ID | WP_001263489.1 |
| Coordinates | 3707634..3708032 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | QDX05_RS18430 | Protein ID | WP_000554758.1 |
| Coordinates | 3708035..3708328 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3703223) | 3703223..3703303 | - | 81 | NuclAT_12 | - | - |
| - (3703223) | 3703223..3703303 | - | 81 | NuclAT_12 | - | - |
| - (3703223) | 3703223..3703303 | - | 81 | NuclAT_12 | - | - |
| - (3703223) | 3703223..3703303 | - | 81 | NuclAT_12 | - | - |
| QDX05_RS18400 (3703899) | 3703899..3704357 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| QDX05_RS18405 (3704618) | 3704618..3706075 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
| QDX05_RS18410 (3706132) | 3706132..3706653 | - | 522 | Protein_3602 | peptide chain release factor H | - |
| QDX05_RS18415 (3706649) | 3706649..3706855 | - | 207 | Protein_3603 | RtcB family protein | - |
| QDX05_RS18420 (3707172) | 3707172..3707624 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
| QDX05_RS18425 (3707634) | 3707634..3708032 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| QDX05_RS18430 (3708035) | 3708035..3708328 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| QDX05_RS18435 (3708380) | 3708380..3709435 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| QDX05_RS18440 (3709506) | 3709506..3710291 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
| QDX05_RS18445 (3710263) | 3710263..3711975 | + | 1713 | Protein_3609 | flagellar biosynthesis protein FlhA | - |
| QDX05_RS18450 (3712199) | 3712199..3712696 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T278248 WP_001263489.1 NZ_CP122929:c3708032-3707634 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A090J8B1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1QAE3 |