Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 38328..38747 | Replicon | plasmid unnamed4 |
| Accession | NZ_CP122927 | ||
| Organism | Escherichia coli strain ETEC1703 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QDX14_RS27260 | Protein ID | WP_247141765.1 |
| Coordinates | 38328..38450 (-) | Length | 41 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 38535..38747 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX14_RS27225 (33648) | 33648..33860 | + | 213 | WP_032084501.1 | hypothetical protein | - |
| QDX14_RS27230 (33982) | 33982..35049 | - | 1068 | Protein_41 | IS66-like element ISCro1 family transposase | - |
| QDX14_RS27235 (35145) | 35145..35492 | - | 348 | WP_213833996.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QDX14_RS27240 (35492) | 35492..35830 | - | 339 | Protein_43 | transposase | - |
| QDX14_RS27245 (35912) | 35912..36277 | + | 366 | WP_000091308.1 | hypothetical protein | - |
| QDX14_RS27250 (36277) | 36277..37464 | + | 1188 | WP_000937592.1 | IS91 family transposase | - |
| QDX14_RS27255 (37654) | 37654..37971 | - | 318 | Protein_46 | IS66 family insertion sequence element accessory protein TnpB | - |
| QDX14_RS27260 (38328) | 38328..38450 | - | 123 | WP_247141765.1 | Hok/Gef family protein | Toxin |
| QDX14_RS27265 (38395) | 38395..38547 | - | 153 | Protein_48 | DUF5431 family protein | - |
| - (38535) | 38535..38747 | - | 213 | NuclAT_0 | - | Antitoxin |
| - (38535) | 38535..38747 | - | 213 | NuclAT_0 | - | Antitoxin |
| - (38535) | 38535..38747 | - | 213 | NuclAT_0 | - | Antitoxin |
| - (38535) | 38535..38747 | - | 213 | NuclAT_0 | - | Antitoxin |
| QDX14_RS27270 (38696) | 38696..39010 | - | 315 | WP_089637073.1 | theronine dehydrogenase | - |
| QDX14_RS27275 (39007) | 39007..39726 | - | 720 | WP_032085152.1 | plasmid SOS inhibition protein A | - |
| QDX14_RS27280 (39723) | 39723..40157 | - | 435 | Protein_51 | conjugation system SOS inhibitor PsiB | - |
| QDX14_RS27285 (40212) | 40212..42170 | - | 1959 | WP_089637074.1 | ParB/RepB/Spo0J family partition protein | - |
| QDX14_RS27290 (42236) | 42236..42469 | - | 234 | WP_032085150.1 | DUF905 family protein | - |
| QDX14_RS27295 (42527) | 42527..43060 | - | 534 | WP_032085149.1 | single-stranded DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | hlyD | 1..107634 | 107634 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 41 a.a. Molecular weight: 4562.36 Da Isoelectric Point: 8.2774
>T278230 WP_247141765.1 NZ_CP122927:c38450-38328 [Escherichia coli]
IVCCTLLIFTHLTRNRLCEVRLKDGYREVTATMAYESGGK
IVCCTLLIFTHLTRNRLCEVRLKDGYREVTATMAYESGGK
Download Length: 123 bp
Antitoxin
Download Length: 213 bp
>AT278230 NZ_CP122927:c38747-38535 [Escherichia coli]
ACTGATTGCCCGTGAACTGGCTGAACGACCGGATTATTTTCAGGGAAAGTGAATGTGGTCAGCGTGCAGGTATATGGGCT
ATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTATCCTGTCGTGTGGCAGAAGGACAAA
AGCCCCGTAGTTAATTTTCATTAACCCACGAGGCCTCTGCATGTCTAGTCCAC
ACTGATTGCCCGTGAACTGGCTGAACGACCGGATTATTTTCAGGGAAAGTGAATGTGGTCAGCGTGCAGGTATATGGGCT
ATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTATCCTGTCGTGTGGCAGAAGGACAAA
AGCCCCGTAGTTAATTTTCATTAACCCACGAGGCCTCTGCATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
