Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 9432..9686 | Replicon | plasmid unnamed4 |
| Accession | NZ_CP122927 | ||
| Organism | Escherichia coli strain ETEC1703 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | QDX14_RS27100 | Protein ID | WP_001312851.1 |
| Coordinates | 9432..9581 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 9625..9686 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX14_RS27065 (5020) | 5020..5802 | + | 783 | WP_001317493.1 | IS21-like element IS100kyp family helper ATPase IstB | - |
| QDX14_RS27070 (5876) | 5876..6061 | - | 186 | Protein_9 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QDX14_RS27075 (6061) | 6061..6345 | - | 285 | WP_032084498.1 | ribbon-helix-helix protein, CopG family | - |
| QDX14_RS27080 (7258) | 7258..8115 | - | 858 | WP_032084499.1 | incFII family plasmid replication initiator RepA | - |
| QDX14_RS27085 (8108) | 8108..8590 | - | 483 | WP_001523473.1 | hypothetical protein | - |
| QDX14_RS27090 (8583) | 8583..8657 | - | 75 | WP_001442103.1 | RepA leader peptide Tap | - |
| QDX14_RS27095 (8891) | 8891..9148 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| QDX14_RS27100 (9432) | 9432..9581 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (9625) | 9625..9686 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (9625) | 9625..9686 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (9625) | 9625..9686 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (9625) | 9625..9686 | + | 62 | NuclAT_1 | - | Antitoxin |
| QDX14_RS27105 (10287) | 10287..10937 | + | 651 | WP_000993931.1 | IS66-like element accessory protein TnpA | - |
| QDX14_RS27110 (10937) | 10937..11284 | + | 348 | WP_213833996.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QDX14_RS27115 (11304) | 11304..12470 | + | 1167 | Protein_18 | IS66 family transposase | - |
| QDX14_RS27120 (12566) | 12566..13321 | - | 756 | WP_047612444.1 | IS21-like element ISSso4 family helper ATPase IstB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | hlyD | 1..107634 | 107634 | |
| - | inside | IScluster/Tn | - | - | 1..15473 | 15472 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T278227 WP_001312851.1 NZ_CP122927:c9581-9432 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT278227 NZ_CP122927:9625-9686 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
