Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 99737..100001 Replicon plasmid unnamed3
Accession NZ_CP122926
Organism Escherichia coli strain ETEC1703

Toxin (Protein)


Gene name pndA Uniprot ID E6BRV3
Locus tag QDX14_RS27015 Protein ID WP_001303307.1
Coordinates 99737..99889 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 99939..100001 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX14_RS26990 (94941) 94941..97108 + 2168 Protein_110 IncI1-type conjugal transfer membrane protein TraY -
QDX14_RS26995 (97184) 97184..97798 + 615 WP_000578649.1 plasmid IncI1-type surface exclusion protein ExcA -
QDX14_RS27000 (97896) 97896..98105 + 210 WP_001140545.1 hemolysin expression modulator Hha -
QDX14_RS27005 (98314) 98314..98490 + 177 WP_001054900.1 hypothetical protein -
- (98976) 98976..99027 + 52 NuclAT_1 - -
- (98976) 98976..99027 + 52 NuclAT_1 - -
- (98976) 98976..99027 + 52 NuclAT_1 - -
- (98976) 98976..99027 + 52 NuclAT_1 - -
QDX14_RS27010 (99414) 99414..99665 + 252 WP_001291965.1 hypothetical protein -
QDX14_RS27015 (99737) 99737..99889 - 153 WP_001303307.1 Hok/Gef family protein Toxin
- (99939) 99939..100001 + 63 NuclAT_0 - Antitoxin
- (99939) 99939..100001 + 63 NuclAT_0 - Antitoxin
- (99939) 99939..100001 + 63 NuclAT_0 - Antitoxin
- (99939) 99939..100001 + 63 NuclAT_0 - Antitoxin
QDX14_RS27020 (100181) 100181..101389 + 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / sul2 / aph(3'')-Ib - 1..102470 102470


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5817.21 Da        Isoelectric Point: 8.7948

>T278223 WP_001303307.1 NZ_CP122926:c99889-99737 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT278223 NZ_CP122926:99939-100001 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A634Q5L1

Antitoxin

Download structure file

References