Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 10763..11027 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP122881 | ||
| Organism | Escherichia coli strain ETEC1716 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | QDX09_RS25105 | Protein ID | WP_001303307.1 |
| Coordinates | 10875..11027 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 10763..10825 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX09_RS25090 (6865) | 6865..7935 | - | 1071 | WP_000151582.1 | IncI1-type conjugal transfer protein TrbB | - |
| QDX09_RS25095 (7954) | 7954..9162 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (9342) | 9342..9402 | - | 61 | NuclAT_1 | - | - |
| - (9342) | 9342..9402 | - | 61 | NuclAT_1 | - | - |
| - (9342) | 9342..9402 | - | 61 | NuclAT_1 | - | - |
| - (9342) | 9342..9402 | - | 61 | NuclAT_1 | - | - |
| QDX09_RS25100 (9469) | 9469..10248 | - | 780 | WP_275450201.1 | protein FinQ | - |
| - (10763) | 10763..10825 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (10763) | 10763..10825 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (10763) | 10763..10825 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (10763) | 10763..10825 | - | 63 | NuclAT_0 | - | Antitoxin |
| QDX09_RS25105 (10875) | 10875..11027 | + | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| QDX09_RS25110 (11099) | 11099..11350 | - | 252 | WP_001291965.1 | hypothetical protein | - |
| - (11737) | 11737..11788 | - | 52 | NuclAT_2 | - | - |
| - (11737) | 11737..11788 | - | 52 | NuclAT_2 | - | - |
| - (11737) | 11737..11788 | - | 52 | NuclAT_2 | - | - |
| - (11737) | 11737..11788 | - | 52 | NuclAT_2 | - | - |
| QDX09_RS25115 (12274) | 12274..12450 | - | 177 | WP_001054900.1 | hypothetical protein | - |
| QDX09_RS25120 (12659) | 12659..12868 | - | 210 | WP_001140545.1 | hemolysin expression modulator Hha | - |
| QDX09_RS25125 (12966) | 12966..13580 | - | 615 | WP_000578649.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| QDX09_RS25130 (13656) | 13656..15824 | - | 2169 | WP_000698360.1 | IncI1-type conjugal transfer membrane protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) | - | 1..118236 | 118236 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T278194 WP_001303307.1 NZ_CP122881:10875-11027 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT278194 NZ_CP122881:c10825-10763 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
