Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 4005845..4006539 | Replicon | chromosome |
Accession | NZ_CP122880 | ||
Organism | Escherichia coli strain ETEC1716 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | QDX09_RS20125 | Protein ID | WP_001263489.1 |
Coordinates | 4005845..4006243 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | QDX09_RS20130 | Protein ID | WP_000554758.1 |
Coordinates | 4006246..4006539 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (4001433) | 4001433..4001513 | - | 81 | NuclAT_12 | - | - |
- (4001433) | 4001433..4001513 | - | 81 | NuclAT_12 | - | - |
- (4001433) | 4001433..4001513 | - | 81 | NuclAT_12 | - | - |
- (4001433) | 4001433..4001513 | - | 81 | NuclAT_12 | - | - |
QDX09_RS20100 (4002109) | 4002109..4002567 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
QDX09_RS20105 (4002828) | 4002828..4004285 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
QDX09_RS20110 (4004342) | 4004342..4004863 | - | 522 | Protein_3937 | peptide chain release factor H | - |
QDX09_RS20115 (4004859) | 4004859..4005065 | - | 207 | Protein_3938 | RtcB family protein | - |
QDX09_RS20120 (4005383) | 4005383..4005835 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
QDX09_RS20125 (4005845) | 4005845..4006243 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
QDX09_RS20130 (4006246) | 4006246..4006539 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
QDX09_RS20135 (4006591) | 4006591..4007647 | - | 1057 | Protein_3942 | DNA polymerase IV | - |
QDX09_RS20140 (4007718) | 4007718..4008503 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
QDX09_RS20145 (4008475) | 4008475..4010187 | + | 1713 | Protein_3944 | flagellar biosynthesis protein FlhA | - |
QDX09_RS20150 (4010411) | 4010411..4010908 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | gmhA/lpcA / rhs/PAAR / clpV/tssH / tssA / tssA / hcp1/tssD1 | 4005845..4043876 | 38031 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T278191 WP_001263489.1 NZ_CP122880:c4006243-4005845 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |