Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 4005845..4006539 Replicon chromosome
Accession NZ_CP122880
Organism Escherichia coli strain ETEC1716

Toxin (Protein)


Gene name yafO Uniprot ID Q47157
Locus tag QDX09_RS20125 Protein ID WP_001263489.1
Coordinates 4005845..4006243 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1QAE3
Locus tag QDX09_RS20130 Protein ID WP_000554758.1
Coordinates 4006246..4006539 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (4001433) 4001433..4001513 - 81 NuclAT_12 - -
- (4001433) 4001433..4001513 - 81 NuclAT_12 - -
- (4001433) 4001433..4001513 - 81 NuclAT_12 - -
- (4001433) 4001433..4001513 - 81 NuclAT_12 - -
QDX09_RS20100 (4002109) 4002109..4002567 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
QDX09_RS20105 (4002828) 4002828..4004285 + 1458 WP_001292994.1 cytosol nonspecific dipeptidase -
QDX09_RS20110 (4004342) 4004342..4004863 - 522 Protein_3937 peptide chain release factor H -
QDX09_RS20115 (4004859) 4004859..4005065 - 207 Protein_3938 RtcB family protein -
QDX09_RS20120 (4005383) 4005383..4005835 - 453 WP_001059892.1 GNAT family N-acetyltransferase -
QDX09_RS20125 (4005845) 4005845..4006243 - 399 WP_001263489.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
QDX09_RS20130 (4006246) 4006246..4006539 - 294 WP_000554758.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
QDX09_RS20135 (4006591) 4006591..4007647 - 1057 Protein_3942 DNA polymerase IV -
QDX09_RS20140 (4007718) 4007718..4008503 - 786 WP_000207552.1 putative lateral flagellar export/assembly protein LafU -
QDX09_RS20145 (4008475) 4008475..4010187 + 1713 Protein_3944 flagellar biosynthesis protein FlhA -
QDX09_RS20150 (4010411) 4010411..4010908 - 498 WP_000006255.1 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - gmhA/lpcA / rhs/PAAR / clpV/tssH / tssA / tssA / hcp1/tssD1 4005845..4043876 38031


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15487.84 Da        Isoelectric Point: 7.4215

>T278191 WP_001263489.1 NZ_CP122880:c4006243-4005845 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.76 Da        Isoelectric Point: 5.2170

>AT278191 WP_000554758.1 NZ_CP122880:c4006539-4006246 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A090J8B1

Antitoxin

Source ID Structure
AlphaFold DB S1QAE3

References