Detailed information of TA system TA278131

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 77071..77492
• Replicon: plasmid unnamed3
• Accession: NZ_CP122871
• Organism: Escherichia coli strain ETEC1721

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QDX04_RS23975
• Protein ID: WP_096937776.1
• Coordinates: 77367..77492 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	77071..77269 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QDX04_RS23935 (72270)	72270..72696	-	427	Protein_79	hypothetical protein	-
QDX04_RS23940 (72766)	72766..72972	+	207	WP_000275848.1	hypothetical protein	-
QDX04_RS23945 (72998)	72998..73537	+	540	WP_000290811.1	single-stranded DNA-binding protein	-
QDX04_RS23950 (73599)	73599..73832	+	234	WP_000005985.1	DUF905 family protein	-
QDX04_RS23955 (73896)	73896..75854	+	1959	WP_000117204.1	ParB/RepB/Spo0J family partition protein	-
QDX04_RS23960 (75909)	75909..76343	+	435	WP_000845912.1	conjugation system SOS inhibitor PsiB	-
QDX04_RS23965 (76340)	76340..77102	+	763	Protein_85	plasmid SOS inhibition protein A	-
- (77071)	77071..77269	+	199	NuclAT_0	-	Antitoxin
- (77071)	77071..77269	+	199	NuclAT_0	-	Antitoxin
- (77071)	77071..77269	+	199	NuclAT_0	-	Antitoxin
- (77071)	77071..77269	+	199	NuclAT_0	-	Antitoxin
QDX04_RS23970 (77276)	77276..77425	+	150	Protein_86	DUF5431 family protein	-
QDX04_RS23975 (77367)	77367..77492	+	126	WP_096937776.1	type I toxin-antitoxin system Hok family toxin	Toxin
QDX04_RS23980 (77793)	77793..77979	-	187	Protein_88	pilus protein	-
QDX04_RS23985 (78039)	78039..78326	+	288	WP_000107541.1	hypothetical protein	-
QDX04_RS23990 (78444)	78444..79265	+	822	WP_001424949.1	DUF932 domain-containing protein	-
QDX04_RS23995 (79561)	79561..80163	-	603	WP_077632063.1	transglycosylase SLT domain-containing protein	-
QDX04_RS24000 (80485)	80485..80868	+	384	WP_001151534.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QDX04_RS24005 (81059)	81059..81706	+	648	WP_000332521.1	conjugal transfer transcriptional regulator TraJ	-
QDX04_RS24010 (81842)	81842..82057	+	216	WP_071782156.1	conjugal transfer relaxosome protein TraY	-
QDX04_RS24015 (82101)	82101..82466	+	366	WP_000338819.1	type IV conjugative transfer system pilin TraA	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	eltB / eltA	1..112141	112141

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4806.72 Da
• Isoelectric Point: 8.4890

>T278131 WP_096937776.1 NZ_CP122871:77367-77492 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 199 bp

>AT278131 NZ_CP122871:77071-77269 [Escherichia coli]
TCATACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC

Structures

Antitoxin